(data stored in ACNUC30630 zone)

EMBL: CP001096.PE65

CP001096.PE65        Location/Qualifiers
FT   CDS_pept        complement(68564..69238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0065"
FT                   /product="protein of unknown function DUF374"
FT                   /note="PFAM: protein of unknown function DUF374; KEGG:
FT                   mag:amb4091 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98627"
FT                   /db_xref="InterPro:IPR007172"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q5Z8"
FT                   /protein_id="ACE98627.1"
FT                   /translation="MATPAFVKRITRSDAVLSLGVNFSKIYFKFVMWTGRYDRQAVPIP
FT                   EPYILAMWHGRLIMAPMLQTKSKPLVALISGHRDGKIISRVGAAFGIQTAVGSSSKGGM
FT                   RAAREMMRLGKSGHSLFVTPDGPRGPRMRINSEGVLDLARLTGLPILPVSVSLSRHKLL
FT                   RSWDRLMLPGLFAKVAIRFGEPITVEAGSPTAEMAERLQAALTAAQNETDRIVGLQPVE
FT                   VA"
     atggccacgc ccgctttcgt caaacggatt acgcgatcag atgcggtcct gtcgctcggc        60
     gtcaactttt ccaagatcta ttttaagttc gtgatgtgga ccggccgata cgatcggcag       120
     gccgttccga tccccgagcc ttacatcctg gcgatgtggc acgggcggct gatcatggcg       180
     ccgatgctgc agaccaagag caagccgctg gtcgcgctga tcagcggaca tcgcgacggc       240
     aagatcattt ccagggtcgg ggccgcgttc gggattcaga ccgcggtcgg ctcaagctcc       300
     aagggcggga tgcgggcggc gcgcgaaatg atgcggctgg gcaagtccgg ccacagcctg       360
     ttcgtcacac ccgacggccc gcgcggtccg cggatgcgca tcaacagcga gggcgttctc       420
     gatctggcgc ggctgaccgg gctgccgatc ctgccggttt cggtcagcct atcgcgtcac       480
     aagctgcttc ggagctggga tcggctgatg ctgccgggat tgttcgcgaa ggtcgcgatc       540
     cggttcggcg agccgatcac cgtcgaggct ggctcgccga ccgcagagat ggcggagcgg       600
     ctgcaggcgg ctctgaccgc cgcgcagaac gaaaccgacc ggatcgtcgg ccttcagccg       660
     gtcgaagtgg cctga                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page