(data stored in ACNUC30630 zone)

EMBL: CP001096.PE70

CP001096.PE70        Location/Qualifiers
FT   CDS_pept        73766..74152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0070"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:blr0743 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98632"
FT                   /db_xref="GOA:B3Q603"
FT                   /db_xref="InterPro:IPR010445"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q603"
FT                   /protein_id="ACE98632.1"
FT                   /translation="MQKFLTALVLIPLGLILVVFAVANRHMVDVSFDPLDPTNPLGHIR
FT                   LPLFVVIIVTAIIGVILGGIATWFGQRRWRRAARRHQAEAIEAQNQLASLRASIATPAQ
FT                   SEPRRLLLESGSSGAGRDKSRATL"
     atgcagaaat tcctgacggc cctggtgctg atcccgctcg gtttgatcct cgtggtgttc        60
     gcggtcgcca accgccacat ggtcgacgtc tcgttcgacc cgctcgaccc cacaaacccg       120
     ctcggccaca tccggctgcc gctgttcgtg gtgatcatcg ttaccgcgat catcggcgtg       180
     atcctcggcg gtatcgccac ctggttcgga cagcggcgct ggcgacgcgc cgcccgccgg       240
     catcaggccg aagcgatcga agcccagaac cagctcgcca gcctgcgcgc cagcatcgcg       300
     acgccggcgc agagcgagcc acgccgcctg ctgctcgaga gcggttccag cggcgccggg       360
     cgcgacaagt cccgcgcgac gttgtaa                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page