(data stored in ACNUC30630 zone)

EMBL: CP001096.PE76

CP001096.PE76        Location/Qualifiers
FT   CDS_pept        complement(79508..79828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0076"
FT                   /product="thioredoxin"
FT                   /note="TIGRFAM: thioredoxin; PFAM: Thioredoxin domain;
FT                   KEGG: bbt:BBta_0091 thioredoxin 1, redox factor"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98638"
FT                   /db_xref="GOA:B3Q609"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q609"
FT                   /protein_id="ACE98638.1"
FT                   /translation="MAVGKVSDADFENEVLNAQGPVVVDFWAEWCGPCRMIAPALDEIA
FT                   GAMGDKVKIVKLNVDESPVTASKYGVMSIPTLMIFKGGEMASRQVGAAPKAKLQQWISA
FT                   AV"
     atggccgttg gtaaggtgtc agacgccgat ttcgaaaacg aggttctcaa cgctcagggg        60
     cctgtggtgg tggacttctg ggccgagtgg tgcggcccgt gccgcatgat cgcgccggcg       120
     ctcgatgaaa tcgccggagc gatgggcgac aaggtcaaga tcgtgaagct caacgtcgac       180
     gagagcccgg tcaccgcctc gaagtacggc gtgatgtcga tcccgaccct gatgatcttc       240
     aagggcggcg agatggcttc gcgccaggtc ggcgccgcgc cgaaggctaa gcttcagcag       300
     tggatcagcg cagcggtctg a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page