(data stored in ACNUC30630 zone)

EMBL: CP001096.PE9

CP001096.PE9         Location/Qualifiers
FT   CDS_pept        complement(10724..12415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0009"
FT                   /product="putative circadian clock protein, KaiC"
FT                   /EC_number="2.7.11.1"
FT                   /note="KEGG: rsq:Rsph17025_3311 KaiB domain protein; PFAM:
FT                   Circadian clock protein KaiC central region; KaiA binding;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98571"
FT                   /db_xref="GOA:B3QK07"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030665"
FT                   /db_xref="UniProtKB/TrEMBL:B3QK07"
FT                   /protein_id="ACE98571.1"
FT                   /translation="MADGISKSLTGIEGFDDLTLGGLPSGRPSLVCGSAGCGKTLFAST
FT                   FLINGARLYDEPGVFVTFEERPVDIVDNVASLGFDLQGLIAQERVLIEHIAIDPTEVAE
FT                   VGDYDLEALFLRLEFAVDQIGAKRIVLDTIESLFSAFQNPAVLRAEIRRLFDWLKQKGL
FT                   TAVITGERGDGTLTRQGLEEYVSDCVILLDHRVDNQISTRRLRIVKYRGTAHGTNEYPF
FT                   LIDEEGFSVLPVSSLGLSHKVHEERISSGVPDLDAMLSGGGFYRGTSVLITGVAGSGKS
FT                   SLACMMVDAACRRGEKALYLSFEESEAQTVRNMKSVGTDLGRWLSTGQLRYIGARPTFY
FT                   SLEMHLAVMLREVARFKPDLVVLDPISAFTESGQIGEVQSMLLRIVDYLKSNGITGAFT
FT                   HLAHGAQTETDAGLSSLMDAWILLLNREAHGEFNRELYLLKARGIAHSNQVREFVMSDD
FT                   GIHLLPPYLGEGGALTGSARRAEEAKERRVESERRTEVARLQDQIEQRRRRALAQIEAL
FT                   KADLAVDEAELQRLTQAEASFRAQSERDVTEMARRRGFIGSADDTD"
     atggcggacg gcatatccaa atctctgacg gggatcgaag ggttcgacga tctcaccctt        60
     ggcggcttgc cctcggggcg ccccagtctg gtgtgcggct cggccggatg cggcaagacg       120
     ctgttcgcgt ccaccttcct gatcaacggt gcgcgcctct atgacgagcc cggcgtgttc       180
     gtcacctttg aagaacgccc ggtcgacatc gtcgataacg tcgcctcgct cggattcgat       240
     ctgcaggggc tgatcgcgca ggagcgggtg ttgatcgagc acatcgcaat cgatccgacc       300
     gaggtcgccg aagtcggtga ctacgatctc gaagcacttt ttctccggct cgagtttgcg       360
     gtcgaccaga tcggcgccaa gcggatcgtg ctcgacacca tcgagagcct gttctcggca       420
     tttcagaatc ccgccgtgct gcgcgccgaa atccggaggc tgttcgactg gctgaagcag       480
     aaggggctga ccgcggtcat caccggcgag cgcggtgacg gcacgctgac taggcagggg       540
     ctcgaagaat acgtctccga ctgcgtcatc ctgctcgatc accgtgtcga caatcagatt       600
     tcgacccgcc gactgcgcat cgtcaaatat cgcggcactg cgcacggcac caacgaatat       660
     ccgttcctga tcgacgaaga gggcttcagc gttctgccgg tgtcttcgct cgggctgtcg       720
     cacaaggtgc acgaggagcg gatctcgagc ggcgttcccg acctcgacgc gatgctgtcc       780
     gggggcgggt tctaccgcgg caccagcgtg ctgatcaccg gcgtcgccgg ctccggcaag       840
     agttcgctgg cctgtatgat ggtcgacgcc gcctgccggc ggggcgagaa ggcactatac       900
     ctgtcatttg aggaatccga ggcgcagacc gtccgcaata tgaaatcggt cggtaccgat       960
     ctcggccgct ggctgagtac cggtcagctt cgctacatcg gggcgcgtcc gacgttctac      1020
     agcctggaaa tgcatctggc agtgatgctg cgcgaagtcg cccgcttcaa gccggacctc      1080
     gtggtgctcg acccgatctc agcgttcacg gagagtgggc agatcggtga agtgcaatcg      1140
     atgctgctgc ggatcgtcga ttatttgaaa tccaacggca tcaccggcgc cttcacgcat      1200
     ctggcgcacg gcgcccagac cgagaccgat gccggcctgt cgtccctgat ggacgcctgg      1260
     atcctgctgc tcaatcgcga agcgcatggc gagttcaatc gcgagcttta tctcttgaag      1320
     gcccgtggca tcgcgcattc caaccaggtg cgcgagttcg tgatgtcgga cgatggcatc      1380
     catctgctgc cgccgtatct cggcgaaggc ggcgcgctga ccgggtcggc gcgcagggcc      1440
     gaagaagcca aggagcgccg cgtcgagagc gagcgccgca ccgaggtggc gcggctgcag      1500
     gatcagatcg agcagcgccg ccggcgtgca ctcgcacaaa tcgaagcgtt gaaggccgat      1560
     cttgcggtcg acgaagcaga gctgcagcgg ctgacccagg cggaagccag ctttcgcgcg      1620
     cagagcgagc gcgatgtcac cgaaatggcg cgaagacggg gtttcatcgg ctcggccgat      1680
     gacacggact ag                                                          1692
//

If you have problems or comments...

PBIL Back to PBIL home page