(data stored in ACNUC30630 zone)

EMBL: CP001096.PE92

CP001096.PE92        Location/Qualifiers
FT   CDS_pept        complement(101934..102152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0092"
FT                   /product="conserved hypothetical protein; putative signal
FT                   peptide"
FT                   /note="KEGG: bra:BRADO0286 conserved hypothetical protein;
FT                   putative signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98654"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q625"
FT                   /protein_id="ACE98654.1"
FT                   /translation="MLKIIGPLVCLTLIAGAAQAQERRPDPGCGRDVSRLCRAVMNESD
FT                   GAILNCLQQHRAKLSAKCAKVLTDNGQ"
     atgttgaaaa tcatcggtcc gctcgtttgc ctcaccctga tcgccggcgc cgcgcaggcg        60
     caggagcgtc gccccgatcc tggctgcggc cgggatgtgt cgcgtctgtg ccgagcggtg       120
     atgaacgagt ccgacggggc gattctgaat tgcctgcagc agcatcgcgc caagctcagc       180
     gccaaatgcg ccaaggtgct gactgacaac ggtcagtaa                              219
//

If you have problems or comments...

PBIL Back to PBIL home page