(data stored in ACNUC30630 zone)

EMBL: CP001096.PE93

CP001096.PE93        Location/Qualifiers
FT   CDS_pept        complement(102281..102622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0093"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:blr3464 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98655"
FT                   /db_xref="InterPro:IPR018968"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q626"
FT                   /protein_id="ACE98655.1"
FT                   /translation="MADKNSSDVILNVMTKNLEQARGAMTNYLEFISKSMSVVPMGQSS
FT                   QATTLKGYVDRNVQATFDFSQQLLHAKDFQDVVRIQTEFLQTQFRVLTDQAKDVVEMTK
FT                   PTVIVPNDG"
     atggcagaca agaactcgtc cgacgtcatc ctgaacgtga tgaccaagaa cctcgagcag        60
     gcgcgcggcg cgatgaccaa ctacctcgag ttcatcagca agagcatgtc ggtggtgccg       120
     atgggccaga gcagccaggc cacgacgctg aagggttacg tcgaccgcaa cgtccaggcg       180
     accttcgatt tctcgcagca gttgctgcat gccaaggact ttcaggacgt ggttcggatc       240
     cagaccgaat tcctgcagac gcaattccgt gtgctcaccg accaggccaa ggacgtcgtc       300
     gagatgacca agccgaccgt catcgttccg aacgacggct ag                          342
//

If you have problems or comments...

PBIL Back to PBIL home page