(data stored in ACNUC30630 zone)

EMBL: CP001096.PE98

CP001096.PE98        Location/Qualifiers
FT   CDS_pept        105276..106193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0098"
FT                   /product="PepSY-associated TM helix domain protein"
FT                   /note="PFAM: PepSY-associated TM helix domain protein;
FT                   KEGG: bja:bll3835 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98660"
FT                   /db_xref="GOA:B3Q631"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q631"
FT                   /protein_id="ACE98660.1"
FT                   /translation="MNNVLLLKLHRWTSLVFALPLLAIIVTGLILSVEPMLQGRGLPAG
FT                   TLDAARLTGLIERYDPQGQARGLAINATGQQMRLLGVNAPPIDLATGEAAAASDATGDL
FT                   LLWARRTHERLLGYEWLVIASTIAMTVLMTIGVLMGLPRLRNSLAGWHKGAAWFTLPLL
FT                   LLSPLTALCMAFGLTFSSGPPPSRVTIKLPDAVQQIAQSHDVSHLAMIANRGGRMMARI
FT                   YQDGELRAYTFTPDGVTALPRNWPRLLHEGNWSTWLSGTLNVITSVVLIVLLITGVWLW
FT                   TRRKLRRRPPSARSAGPVLAAPLS"
     atgaacaacg tacttctgct caaactgcat cgctggacca gtctggtgtt cgcgctgccg        60
     ctgctcgcca tcatcgtcac cggactcatt ctgtcggtcg agccgatgct gcaaggccgc       120
     ggcctgccgg ccggaacgct cgatgccgcc cgcctcacgg gcctgatcga acgctacgat       180
     ccgcagggcc aggcgcgcgg gctcgcgatc aacgccaccg gccaacaaat gcgcctgctc       240
     ggggtcaatg cacccccgat cgacctcgca accggcgaag ccgcagccgc cagcgacgcc       300
     accggcgacc tgctgctatg ggcgcggcgc acccatgagc gcctgctcgg ctacgagtgg       360
     ctggtgatcg cctcgaccat cgccatgacg gtgctgatga cgatcggcgt actgatgggg       420
     ctaccgcggc tgcgcaacag cctcgccggc tggcacaagg gcgcggcgtg gttcacgctg       480
     ccgcttctgc tgctgagccc gctcaccgcc ctgtgcatgg cgttcgggct gacgttctcc       540
     agcggcccgc cgccgtcgcg cgtcaccatc aagctgccgg acgcggtgca gcagatcgcg       600
     cagtcgcacg acgtgtcgca tctggcgatg atcgccaatc gcggcggacg aatgatggcg       660
     cggatctacc aggacggtga gctgcgcgcc tacactttta cgccggacgg cgtcaccgcg       720
     ctgccgcgca actggccgcg gctgctgcac gaaggcaatt ggtcgacgtg gctgtcgggc       780
     acgctcaacg tcatcacctc ggtggtactg atcgtcctgc tgatcaccgg cgtctggctg       840
     tggacccggc gcaagctgcg gcggcggcct ccgtctgcgc gtagcgccgg tccggtcctc       900
     gctgcgccgc tgtcctag                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page