(data stored in ACNUC7421 zone)

EMBL: CP001111.PE1

CP001111.PE1         Location/Qualifiers
FT   CDS_pept        215..1546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: xac:XAC0001 chromosomal replication initiation
FT                   protein; TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA domain;
FT                   Chromosomal replication initiator DnaA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49706"
FT                   /db_xref="GOA:B4SU11"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SU11"
FT                   /protein_id="ACF49706.1"
FT                   /translation="MDAWSRSLERLEAEFPPEDVHTWLKPLQADLRVDSLVLYAPNAFI
FT                   VDQVRELYLARIRELLAHFAGFSDVFLEIGSRPRPVEAQNAPFSTPSAHVSSEPQVPFA
FT                   GNLDNHYTFANFVEGRSNQLGLAAAFQAAQKPGDRAHNPLLLYGGTGLGKTHLMFAAGN
FT                   AMRQANPGAKVLYLRSEQFFSAMIRALQEKTMDQFKRQFQQVDALLIDDIQFFAGKDRT
FT                   QEEFFHTFNALFDGKQQIILTCDRYPREVEGLEARLKSRLAWGLSVAIEPPDFETRAAI
FT                   VLAKARERGAEIPDDVAFLIAKKMRSNVRDLEGALNTLTARANFTGRAITTEFAQETLR
FT                   DLLRAQQQAISIPNIQKTVADYYGLQIKDLLSKRRTRSLARPRQVAMALTKELTEHSLP
FT                   EIGDAFAGRDHTTVLHACRQIRTLMEADGKLREDWDKLIRKLSE"
     atggatgcct ggtcccgtag tctcgagcgc ctcgaagcgg agttcccgcc ggaagacgtt        60
     cacacctggt tgaagccact gcaggccgat ctgcgcgtgg acagcctggt gctgtatgca       120
     ccgaatgcct tcatcgtcga ccaggtacgc gaactgtacc tggcccggat ccgcgaactg       180
     ctggcccact tcgccggttt cagcgacgtt tttcttgaaa tcggctcgcg cccgcggccc       240
     gtggaggcgc agaacgcgcc gttttccacg ccgtcggcac atgtttccag cgaaccgcag       300
     gtaccgttcg ccggcaacct ggacaatcac tacaccttcg ccaacttcgt cgaaggccgc       360
     agcaaccagc tgggcctggc cgctgccttc caggcggcgc agaagccggg cgaccgtgcg       420
     cacaatccgc tgctgctgta cggaggcacc ggcctgggca agacccacct gatgttcgcc       480
     gccggcaacg ccatgcgcca ggccaacccg ggggcgaagg tgctgtacct gcgctcggaa       540
     cagttcttca gcgcgatgat ccgggccttg caggaaaaga ccatggatca gttcaagcgc       600
     cagttccagc aggtggacgc gctgctgatc gatgacatcc agttcttcgc cggcaaggac       660
     cgcacccagg aagagttctt ccacaccttc aacgcgttgt tcgatggcaa gcagcagatc       720
     atcctgacct gcgaccgcta tccgcgcgaa gttgaaggcc tggaagcgcg cctgaagtcg       780
     cggcttgcct ggggcctgtc ggtcgcgatc gaaccgccgg acttcgagac ccgcgcggcg       840
     atcgtgctgg ccaaggcccg cgagcgcggt gccgagattc ccgatgatgt tgcgttcctg       900
     atcgccaaga agatgcgctc caacgtgcgc gacctcgagg gcgcgctgaa taccctgacc       960
     gctcgtgcca atttcaccgg ccgtgcgatc accactgaat tcgcccagga aactctgcgc      1020
     gatctgctgc gcgcccagca gcaggcgatc agcattccca acatccagaa aacggttgcc      1080
     gactactacg gcctgcagat caaggatctg ctgtccaagc gccggacccg ttcgctggct      1140
     cgtccgcgcc aggtcgccat ggccctgacc aaggagctga ccgagcacag cctgcctgag      1200
     atcggcgacg ccttcgccgg tcgcgaccac accacggtgc tgcatgcctg ccgtcagatc      1260
     cgcaccctga tggaggccga cggcaagctc cgcgaggact gggacaagct gatccggaag      1320
     ctgagcgaat ga                                                          1332
//

If you have problems or comments...

PBIL Back to PBIL home page