(data stored in ACNUC7421 zone)

EMBL: CP001111.PE10

CP001111.PE10        Location/Qualifiers
FT   CDS_pept        12428..12853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0010"
FT                   /product="Biopolymer transport protein ExbD/TolR"
FT                   /note="PFAM: Biopolymer transport protein ExbD/TolR; KEGG:
FT                   xcb:XC_0010 biopolymer transport ExbD1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49715"
FT                   /db_xref="GOA:B4SR14"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR14"
FT                   /protein_id="ACF49715.1"
FT                   /translation="MAFSSGNSGGPMADINVTPLVDVMLVLLIIFIITAPLMSHKVKVD
FT                   LPEANLVQKPDDTNDRKGPITLAVKEDGSIYWNDEEINKQTLESRLATAAQQTPQPPLN
FT                   LRGDRTTKMRVINEMTKIAQEQGMLDVGFVATKEKGQ"
     atggctttca gtagtggtaa cagcggcggc cccatggccg acatcaacgt tacgcccctc        60
     gtggacgtga tgctggtgct gctgatcatc ttcatcatca cggcgcccct gatgtcccac       120
     aaggtcaagg tggatctgcc ggaggccaac ctggtccaga agccggacga caccaacgat       180
     cgcaagggtc ccatcaccct ggcagtcaag gaagatggct cgatctactg gaacgacgaa       240
     gaaatcaaca agcagactct cgagtcgcgc ttggcgaccg ccgcccagca gaccccgcag       300
     ccgccgttga acctgcgtgg tgaccgcacc accaagatgc gcgtcatcaa cgagatgacc       360
     aagatcgcgc aggaacaggg catgctggac gtcggcttcg ttgcgaccaa agaaaagggg       420
     caataa                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page