(data stored in ACNUC7421 zone)

EMBL: CP001111.PE100

CP001111.PE100       Location/Qualifiers
FT   CDS_pept        122612..123229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0100"
FT                   /product="YceI family protein"
FT                   /note="PFAM: YceI family protein; KEGG: xac:XAC0194
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49805"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRT5"
FT                   /protein_id="ACF49805.1"
FT                   /translation="MSLARRSRFLLPVLLVSGPAWAAAPPPTTLPPVVAEAHRVLRLDT
FT                   QRSQIGFEVRTRFGQRIEGVFPHFEGRIEILSDGRHQVHLKMFTRSVEIPGKPRYTGWM
FT                   RGEEFFDAGRHPVVEFDSLPYWPETVEDGGDINGRLTLRGISHPESLKVEKADCARPGY
FT                   DCDVVSRGTVQRGRYGMESWQLALSDRVTFVLRARLSEAPKP"
     atgagcctgg cgcggcgcag ccgcttcctg ctgcccgtgc tgctggtatc cggcccggcc        60
     tgggctgccg caccaccgcc cacgacattg ccaccggtgg tcgccgaggc gcaccgcgtg       120
     ttgcgcctgg acacgcagcg ttcgcagatc ggtttcgagg tgcgcacccg cttcgggcag       180
     cgcatcgagg gcgtgtttcc gcacttcgag ggacgcatcg agatcctctc cgacggccgc       240
     caccaggtgc acctgaagat gttcacgcgc tcggtcgaga ttcccggcaa gccgcgctac       300
     accggttgga tgcgcggtga ggagttcttc gatgccggcc gccatccggt ggtcgaattc       360
     gactccctgc cgtactggcc ggagaccgtg gaggacgggg gcgacatcaa cggcaggttg       420
     accctgcgtg ggatcagcca cccggagtcg ctcaaggtcg agaaggcgga ctgcgcccga       480
     cccggctatg attgcgacgt cgtcagccgc ggtaccgtgc aacgaggccg gtatggcatg       540
     gaaagctggc agcttgcctt gagtgaccga gtgactttcg tattgcgtgc gcgcctgagc       600
     gaggcgccta aaccgtga                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page