(data stored in ACNUC7421 zone)

EMBL: CP001111.PE105

CP001111.PE105       Location/Qualifiers
FT   CDS_pept        127732..129801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0105"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_4; Tetratricopeptide TPR_2 repeat
FT                   protein; SMART: Tetratricopeptide domain protein; KEGG:
FT                   xac:XAC0199 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49810"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRU0"
FT                   /protein_id="ACF49810.1"
FT                   /translation="MQDQIIQALRQNQADQAVQLAQAWTRDEPGLAEAHRWLALALQQQ
FT                   GNAEHAMDALQEALRLAPDDAQLHLQQAGLLLALRQFEGADEALARTTGLDPNSFSAYL
FT                   MQAHLAIGRNDFDEAARVSTLASRVEPDHPELLTIDGMVALRRGDADRALSLLSAASKA
FT                   LPDDPRVLYALGFAYLGKDMLAFAEQSFRRVLELNPSLSSLHGLVVQLALRQGNVPAAA
FT                   EAMQVALQQPQMDVPAMRRLAGELSLRSGQPLQALEYLLPLLETQPDDRQMLQLLLMSW
FT                   QRLGREDEARARLDAVLENNDQLHDVWLARLAIEQVGSESAVTAVERWMAAMPEHLPAL
FT                   EARLRLHDMAGEHAQAEAIAERIVSQEPGRVSGETRLVEGLLQRDPAAAVARVQALIDL
FT                   APEGHRADLRTWMGEIQDRAAQPQEALRTWMALQADQAPQRLPLPPQAKAPPSWPDKGD
FT                   IDGDATSAPIFLWGAPGSGVERVATGLAAASPVLRSDRYTNTPPDDAFQNYHTLQDLAS
FT                   GVLTPERLVERWREQLPARGLQNDTVIDWLLWWDNALLWALRPQLPQGRLLLVLRDPRD
FT                   MLLDWVAYGAAAPLAMTSLAEAGEWLARALTQVATLHEEDLYPHVLLRIDHIGNDPQAM
FT                   AELLGRLFERPMPPAAQLGAPRLPPGHWRNYRDVMSAAFALLTPIAVRLGYPEE"
     atgcaagacc agatcatcca agcgctgcgc cagaaccagg ccgaccaggc cgtgcagctg        60
     gcccaggcgt ggacccgtga tgaacccggc ctggccgaag cccaccgctg gctggcgctt       120
     gcgctgcagc agcagggcaa cgccgagcac gcgatggacg ccctgcagga ggcgctgcgc       180
     ctggccccgg acgatgccca gctgcacctg cagcaggccg gcctgctgct ggccctgcgc       240
     cagttcgaag gtgctgacga ggcgttggcg cgcaccaccg gcctcgatcc gaattccttc       300
     tccgcctacc tgatgcaggc gcacctggcg atcggccgca acgacttcga cgaagcggcg       360
     cgcgtgtcga cgttggcgtc gcgcgtcgag ccggatcacc cggagctgct gaccatcgac       420
     ggcatggttg ccctgcgccg cggcgatgcg gatcgcgcgc tgtcgctgct gtcggccgcc       480
     agcaaggcgt tgccggacga tccccgcgtg ttgtatgcac tgggttttgc ctatctgggc       540
     aaggacatgc tggcgttcgc cgagcagtcg ttccgtcgcg tgctggaact gaacccgtcg       600
     ctttcctcgt tgcacggcct ggtggtgcag ctggcgctgc gccagggcaa tgtgccggct       660
     gcggccgaag cgatgcaggt ggccctgcag cagccgcaga tggacgtgcc ggcgatgcgt       720
     cgcctggccg gcgagctgtc gctgcgcagc ggccagccgc tgcaggcgct ggagtacctg       780
     ctgccgctgc tggaaacgca gccggatgac cgccagatgc tgcagctgct gctgatgtca       840
     tggcagcgcc tggggcgtga ggatgaagca cgtgctcgac tggacgcggt gctggaaaac       900
     aatgaccagc tgcacgacgt gtggctggcg cggctggcga tcgagcaggt gggcagcgaa       960
     agtgcggtga ccgctgtcga gcgctggatg gcagcgatgc ccgagcatct gccggcactt      1020
     gaggcacgcc tgcgcctgca cgacatggcc ggtgaacatg cgcaggccga agcgattgcc      1080
     gagcgtatcg tcagccagga gccgggtcgt gtcagtggcg aaacccgcct ggttgaaggc      1140
     ctgctgcaac gggatccggc cgctgccgtg gctcgcgtgc aggcactgat cgacctggcg      1200
     ccggaaggcc atcgcgccga tctgcggacg tggatgggcg agatccagga ccgtgccgcg      1260
     cagccgcagg aagcgctgcg tacgtggatg gcgctgcagg ccgaccaggc gccgcagcgc      1320
     ctgccgctgc cgccgcaggc caaggccccg ccgagctggc cggacaaggg cgatatcgac      1380
     ggtgatgcca cctccgcgcc gatcttcctg tggggcgcac cgggttcggg cgtggagcgc      1440
     gtggcgaccg gcctggccgc cgccagcccg gtgctgcgca gtgaccgcta caccaacacg      1500
     ccgcccgatg atgcgttcca gaactaccac acgctgcagg atctggcctc gggcgtgctg      1560
     accccggagc ggctggtgga acgctggcgc gaacagctgc cggcacgtgg cctgcagaac      1620
     gacaccgtga tcgactggtt gctgtggtgg gacaacgccc tgctgtgggc gctgcgcccg      1680
     cagctgccgc agggccgcct gctgctggtg ctgcgtgacc cgcgcgacat gctgctggac      1740
     tgggtggcct acggcgccgc cgcgccgctg gcgatgacct cgctggccga agccggtgag      1800
     tggctggcgc gtgcgttgac ccaggtcgcc acgttgcatg aggaagacct gtacccacat      1860
     gtactgctgc gcatcgacca tatcggcaac gatccgcagg caatggctga actgctcggc      1920
     cgcctgttcg agcggccgat gccgccggcg gcgcagctgg gtgcaccgcg cctgccgcct      1980
     ggccattggc gcaactaccg cgacgtgatg agcgccgctt tcgccctgct caccccgatt      2040
     gcggtgcgcc tgggttaccc ggaagagtga                                       2070
//

If you have problems or comments...

PBIL Back to PBIL home page