(data stored in ACNUC7421 zone)

EMBL: CP001111.PE109

CP001111.PE109       Location/Qualifiers
FT   CDS_pept        132476..133885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0109"
FT                   /product="glutamine synthetase, type I"
FT                   /note="TIGRFAM: glutamine synthetase, type I; PFAM:
FT                   glutamine synthetase catalytic region; glutamine synthetase
FT                   beta-Grasp; KEGG: xcb:XC_0194 glutamine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49814"
FT                   /db_xref="GOA:B4SRU4"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRU4"
FT                   /protein_id="ACF49814.1"
FT                   /translation="MSVENVEKLIKDNQIEFVDLRFVDMRGVEQHVTFPVSIVEPSLFE
FT                   EGKMFDGSSIAGWKGIAESDMVLLPDTASAYVDPFYADPTIVISCDILDPATMQPYGRC
FT                   PRGIAKRAEAYLKSSGIAETAFFGPEPEFFIFDSVRFANEMGHTFFQVDSEEAAWNSGA
FT                   KYDGANSGYRPGVKGGYFPVPPTDTLHDLRAEMCKTLEQVGIEVEVQHHEVATAGQCEI
FT                   GTKFSTLVQKADELLRMKYVIKNVAHRNGKTVTFMPKPIVGDNGSGMHVHQSLSKGGTN
FT                   LFSGDGYGGLSQLALWYIGGIFKHAKAINAFANSGTNSYKRLVPGYEAPVMLAYSARNR
FT                   SASCRIPWVSNPKARRIEMRFPDPIQSGYLTFTALMMAGLDGIKNQIDPGAPSDKDLYD
FT                   LPPEEEKLIPQVCSSLDQALEALDKDREFLKAGGVMSDDFIDGYIALKMQEVTKFRAAT
FT                   HPLEYQLYYAS"
     atgtccgtgg aaaacgttga gaagctgatc aaggacaacc agatcgagtt cgtcgacctg        60
     cgctttgtcg acatgcgtgg tgtcgagcag cacgtgacct tcccggtcag catcgtcgag       120
     ccgtcgctgt tcgaagaagg caagatgttc gatggcagct cgatcgccgg ctggaagggc       180
     atcgccgaat cggacatggt gctgctgccg gataccgcca gcgcctacgt cgacccgttc       240
     tacgccgatc cgaccatcgt gatcagctgc gacatcctcg atccggccac catgcagccg       300
     tatggccgtt gcccgcgcgg catcgccaag cgggccgagg cctacctgaa gtcctccggc       360
     atcgccgaaa ccgcgttctt cggcccggag ccggaattct tcatcttcga ttcggtccgc       420
     ttcgccaatg aaatgggcca caccttcttc caggtcgatt cggaagaagc ggcgtggaac       480
     agcggcgcca agtacgacgg cgccaacagc ggctaccgtc cgggcgtgaa gggcggttac       540
     ttcccggtgc cgccgaccga caccctgcac gacctgcgcg ccgagatgtg caagaccctg       600
     gaacaggtcg gcatcgaagt ggaagtgcag caccacgaag tggccaccgc cggccagtgc       660
     gagattggca ccaagttcag caccctggtg cagaaggccg acgaactgct gcgcatgaag       720
     tacgtgatca agaacgtcgc gcaccgcaac ggcaagaccg tcaccttcat gcccaagccg       780
     atcgtcggcg acaacggcag cggcatgcac gtgcaccagt cgctgtccaa gggcggcacc       840
     aacctgttct ccggcgacgg ctacggcggc ctgagccagc tggcgctgtg gtacatcggc       900
     ggcatcttca agcatgccaa ggccatcaat gccttcgcca actcgggcac caacagctac       960
     aagcgcctgg tgccgggcta cgaagcaccg gtgatgctgg cctactcggc ccgcaaccgt      1020
     tcggcttcgt gccgcattcc gtgggtgtcc aacccgaagg cacgccgcat cgaaatgcgc      1080
     ttcccggatc cgatccagtc cggctacctc accttcaccg cgctgatgat ggccggcctg      1140
     gacggcatca agaaccagat cgacccgggc gcaccgagcg acaaggacct gtacgacctg      1200
     ccgccggaag aagagaagct gatcccgcag gtctgctcct cgctggacca ggcgctggaa      1260
     gcgctggaca aggaccgtga gttcctgaag gccggcggcg tgatgagcga tgacttcatc      1320
     gacggctaca tcgcgctgaa gatgcaggaa gtgaccaagt tccgcgcggc cacccacccg      1380
     ctggaatatc agctgtacta cgccagctga                                       1410
//

If you have problems or comments...

PBIL Back to PBIL home page