(data stored in ACNUC7421 zone)

EMBL: CP001111.PE110

CP001111.PE110       Location/Qualifiers
FT   CDS_pept        134155..134493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0110"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   xac:XAC0205 nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49815"
FT                   /db_xref="GOA:B4SRU5"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRU5"
FT                   /protein_id="ACF49815.1"
FT                   /translation="MKLISAIIRPFKLDEVREALSDAGVSGITVTEVKGFGRQKGHTEL
FT                   YRGAEYVVDFLPKIKIETVVTDERADAVIEAIQSSAGTGKIGDGKIFVTAVEQVIRIRT
FT                   GEIGADAL"
     atgaaactga tctccgccat catccgaccg ttcaagctcg acgaggtccg cgaggccttg        60
     tccgatgccg gcgtgtcggg catcaccgtg accgaagtga aaggcttcgg tcgccagaag       120
     ggccacaccg agctgtatcg cggtgccgag tacgtggtcg atttcctgcc caagatcaag       180
     atcgaaaccg tggtcaccga cgagcgtgcc gatgcggtga tcgaagcgat ccagtcgtcg       240
     gcaggcaccg gcaagatcgg tgacggcaag attttcgtca ccgccgtcga acaggtcatc       300
     cgcatccgca ccggcgaaat cggtgccgac gcgctgtaa                              339
//

If you have problems or comments...

PBIL Back to PBIL home page