(data stored in ACNUC7421 zone)

EMBL: CP001111.PE119

CP001111.PE119       Location/Qualifiers
FT   CDS_pept        158433..159593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0119"
FT                   /product="MltA domain protein"
FT                   /note="PFAM: MltA domain protein; 3D domain protein; KEGG:
FT                   pst:PSPTO_1025 transglycosylase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49824"
FT                   /db_xref="GOA:B4SRV4"
FT                   /db_xref="InterPro:IPR005300"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR026044"
FT                   /db_xref="InterPro:IPR034654"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRV4"
FT                   /protein_id="ACF49824.1"
FT                   /translation="MKDIIAPLSRTSLSLLALAVLAACSTTGTRPEAPPAPIKPAATYA
FT                   KVEWSALPPVSDTDLQAGFVAWRSSCARLKNDAVWAKPCTTAAAVNDKDPAAIRQFLQR
FT                   DLDVYALRAGGHQADGLITGYYEPIYPGSLTRTDKATVPVYGTPDDLIVVQLDSVYPEL
FT                   KGKRLRGRVEGKVLKPYDDAGTIAAKGAKAPVLAWLTDPMDLQLLQIQGSGRVRLADGK
FT                   QVRLAYAEQNGHPYRAIGRWLVDQGQLKKEDVTMDAIRAWARANPSRVPELLRSNPSYV
FT                   FFVRNPDSPEGPRGSLNVPLTAGYSVAVDRTVVPLGSLLWLSTTRPDGSPVVRPVAAQD
FT                   TGGAIAGEVRADLYWGSGDAAGKLAGDMKQKGNIWMLWPKGSPLPK"
     atgaaagaca tcatcgcccc cctgagccgc acgagcttga gccttcttgc gctggccgtg        60
     cttgcggcct gcagcaccac cggcacccgt cccgaagcac cgccagcacc aatcaagcct       120
     gccgccacct acgccaaggt tgaatggagt gcgctgccgc cggtttccga taccgatctg       180
     caggccggct tcgtcgcctg gcgcagcagt tgtgccaggt tgaagaacga cgcggtctgg       240
     gccaagccct gcaccacggc tgcagcagtg aacgacaagg accctgccgc gatccgccag       300
     ttcctgcagc gcgacctcga tgtctacgcg ctgcgtgccg gggggcacca ggctgatggg       360
     ctgatcaccg gctactacga gccgatctac cccggcagcc tgacccgaac cgacaaggcc       420
     accgtgccgg tgtacggcac gccagatgac ctgatcgtgg tgcagctgga cagcgtctac       480
     ccggaactga agggcaagcg cctgcgcggg cgcgtcgaag gcaaggtgct caagccctat       540
     gacgacgccg gtaccatcgc ggccaagggc gccaaggccc cggtgctggc ctggctgacc       600
     gatccgatgg acctgcagtt gctgcagatc cagggctcgg gccgggtgcg cctggccgat       660
     ggcaagcagg tgcggctggc ctatgccgaa cagaacggcc acccgtaccg cgcgatcggc       720
     cgctggctgg tggaccaggg ccagctgaag aaggaagacg tgaccatgga tgcgatccgc       780
     gcatgggcca gggccaaccc ttcccgcgtg ccggaactgc tgcgcagcaa tcccagctac       840
     gtgttcttcg tgcgcaaccc ggacagcccg gaaggccccc gcggttcact gaacgtgccg       900
     ctcaccgccg gctacagcgt ggcggtggac cgtaccgtgg taccgctggg cagcctgttg       960
     tggctgtcca ccacgcgtcc ggatggcagc ccggtggtac gcccggtggc cgcgcaggac      1020
     accggcggtg ccattgccgg cgaagtacgc gcggacctgt actggggcag cggcgacgcc      1080
     gcaggcaagc tggccggtga catgaagcag aagggcaaca tctggatgct gtggccgaag      1140
     ggctccccct tgccgaagta g                                                1161
//

If you have problems or comments...

PBIL Back to PBIL home page