(data stored in ACNUC7421 zone)

EMBL: CP001111.PE121

CP001111.PE121       Location/Qualifiers
FT   CDS_pept        160084..162129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0121"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: xac:XAC0690 TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49826"
FT                   /db_xref="GOA:B4SRV6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRV6"
FT                   /protein_id="ACF49826.1"
FT                   /translation="MKTSTLVAALAAAPFAPEALAQSADAALTLGKVDVHQHGEGQLSA
FT                   HQVLTSVDVLGADQIEDRNVSHSWELLGQMPGIQLTETRQGAESGKVSFRAFNGEGYLN
FT                   AIKTLIDGIPSNVNSGNQRYIDMLFPLEISYIEVVRGTNDPRYGLHNIGGNVNFGTRQG
FT                   GNYTDARLAYGSYNTRDAQLAVGREANGVAQNYFVGTQASDGYRDHDTSRKYSLGGKWF
FT                   LGTLDDGLRVGLTARAYHHEADEPGFMTVEEMRTHRRGSDLRNGNDGDDRDMRQIAAHL
FT                   DMKLSERLTFGTRLYYNRYEDDRRVTFSDLPTGNLPRQRRVWDERQNGLLSTVTWQASP
FT                   ALTVEGGLNYEQQDNSYIRERYAYAEPTDFSRAPARVQNNDRHSFDNWGAYVQAIYQPV
FT                   EAWKIVPAYRVDRFSGRTHLMNGLSARLQDYGSIGQPKLSVIHSLGENTHVYANWGRTF
FT                   QVLTGSTAPAYLAPGQARMRPSTNTGMELGLKFQPFAGSQARLAVWQQDAENEVSNMPA
FT                   TGTTVTLGKTRRRGVDAQLSLQLGDDWTVWASHAYQEAKITRDDRDASMSLRGREVAAT
FT                   PRHISNLGVDYHASDALRLGLQARAQGDYYLEERNVAGKFGGFAVLDLSAAYQITPRWS
FT                   VDLQLKNVTGRQYAYAWYDSFFWDSARPMFSPAPGRSVFVGLNMKL"
     atgaagacct ccacgctggt ggccgccctc gcggccgcgc cgttcgcccc tgaagcactc        60
     gcacagtcgg cggatgccgc gctcaccctg ggcaaggtcg atgtgcacca gcacggcgaa       120
     ggccagctga gcgcgcacca ggtactgact tcggtggacg tgctgggcgc agaccagatc       180
     gaagaccgca acgtctccca cagctgggag ctgctggggc agatgccggg catccagctg       240
     accgaaaccc ggcagggtgc cgaatcgggc aaggtcagct tccgggcttt caacggcgag       300
     ggctacctca atgccatcaa gacgctgatc gatggcatcc ccagcaacgt caacagcggc       360
     aaccagcgct acatcgacat gctgttcccg ctggaaatca gctacatcga agtggtacgt       420
     ggtaccaacg acccgcgcta cggcctgcac aacatcggcg gcaacgtgaa cttcggtacg       480
     cgccagggtg gcaactacac cgatgcacgg ctggcctacg gcagctacaa cacccgtgat       540
     gcgcagctgg cggtgggccg cgaagccaat ggcgtcgcgc agaactactt cgttggtacc       600
     caggccagcg atggctatcg cgaccatgac acctccagga agtactcgct gggcggcaaa       660
     tggttcctcg gcacgctgga cgatgggctg cgcgtgggcc tgaccgcgcg cgcctaccac       720
     cacgaagccg acgagcccgg cttcatgacc gtcgaggaaa tgcgtacgca tcgacgtggc       780
     agcgacctgc gcaacggcaa cgatggtgat gaccgcgaca tgcgccagat tgccgcgcac       840
     ctggatatga aactgtccga gaggctcacc ttcggcacgc ggctctatta caaccgctac       900
     gaagacgacc gccgcgtgac cttcagcgac ctgcccaccg gcaacctgcc gcgccagcgc       960
     cgcgtgtggg atgagcggca gaatggcctg ctcagcacgg tcacctggca ggccagcccc      1020
     gcgcttactg tcgagggcgg cctgaactac gagcagcagg acaacagcta catccgcgag      1080
     cgctacgcct acgccgaacc caccgacttc agccgtgccc cggcacgggt gcagaacaac      1140
     gaccgccaca gcttcgacaa ttggggcgcc tacgtgcagg ccatctacca gcccgtcgag      1200
     gcgtggaaga tcgtgccggc ctaccgtgtg gaccgcttca gtggccgtac ccacctgatg      1260
     aacggcctca gcgctcggct gcaggattac ggcagcatcg gccagcccaa actgagcgtc      1320
     atccacagcc tgggcgagaa cacccacgta tacgcaaact ggggccgcac cttccaggtg      1380
     ctcactggat ccaccgcgcc ggcttacctc gccccgggcc aggcgcggat gcgtccgtcc      1440
     accaacaccg gcatggagct gggcctgaag ttccagccgt tcgcgggcag ccaggcgcgc      1500
     ctggcggtgt ggcagcagga cgcggaaaac gaggtatcca acatgccggc caccggtacg      1560
     acggtcacct tgggcaagac ccgtcgacgc ggcgtggatg cgcagttgag cctgcagctg      1620
     ggcgacgact ggacggtctg ggcgtcgcac gcctaccagg aagcgaagat cacccgcgac      1680
     gaccgcgatg ccagcatgtc cctgcggggc cgcgaagtgg ccgccacccc gcgccacatc      1740
     agcaacctgg gtgtggacta ccacgccagc gatgccttgc gcctgggcct gcaggcgcgt      1800
     gcacagggcg attactacct ggaagagcgc aacgtggccg gcaagttcgg tggtttcgcc      1860
     gtgctcgacc tgagcgccgc ctaccagatc accccgcgct ggagcgtgga cctgcagctg      1920
     aagaacgtta ccggacgcca gtacgcctac gcctggtacg acagcttctt ctgggacagc      1980
     gcccgcccga tgttttcgcc ggccccgggc cgtagcgtgt tcgtcggcct caacatgaag      2040
     ctgtga                                                                 2046
//

If you have problems or comments...

PBIL Back to PBIL home page