(data stored in ACNUC7421 zone)

EMBL: CP001111.PE124

CP001111.PE124       Location/Qualifiers
FT   CDS_pept        164841..165410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0124"
FT                   /product="superoxide dismutase copper/zinc binding"
FT                   /note="PFAM: superoxide dismutase copper/zinc binding;
FT                   KEGG: xoo:XOO4482 superoxide dismutase like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49829"
FT                   /db_xref="GOA:B4SRV9"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="InterPro:IPR018152"
FT                   /db_xref="InterPro:IPR024134"
FT                   /db_xref="InterPro:IPR036423"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRV9"
FT                   /protein_id="ACF49829.1"
FT                   /translation="MRLSFAILPLSAAVLLSACGSAPKKPQPTPPPPTVVGTAKQAEAN
FT                   LSPASASIVSGRIALVVEPGGIHITGLIGGLQPMQQAGFHIHERGDCSAVDASSAGNHF
FT                   NPGGTAHGRAGTGKHHLGDMDNLRADAQGRANVDIHLKGVTLGGGAATDIAGRALVVHA
FT                   NADDYRSQPAGNAGVRIACGVIRVVR"
     atgcgtctgt cctttgccat cctgccgttg tccgccgccg tgctgctgtc tgcctgtggc        60
     agtgcgccga agaagccgca gcccacaccg ccgccgccga ccgtagtcgg caccgccaaa       120
     caggccgagg ccaatctctc gccggcctcg gccagcatcg tcagtggccg catcgcgctg       180
     gtggtggagc ccggtggcat ccacatcacc ggcctgatcg gtggcctgca gccgatgcag       240
     caggccggct tccacatcca cgagcgcggt gactgcagcg cggtggatgc cagcagcgcc       300
     ggcaaccact tcaaccccgg tggcaccgcg catggccgcg caggcaccgg caagcaccac       360
     ttgggcgaca tggacaatct gcgtgccgac gcccagggcc gcgccaacgt cgatatccac       420
     ctcaaggggg ttacccttgg cggaggcgcc gccaccgata tcgccggacg tgcactggtc       480
     gtgcatgcaa atgccgacga ctatcgcagc cagcccgccg gcaatgccgg cgttcgcatc       540
     gcctgtggcg tgatccgggt tgtccgttga                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page