(data stored in ACNUC7421 zone)

EMBL: CP001111.PE127

CP001111.PE127       Location/Qualifiers
FT   CDS_pept        complement(167311..168198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0127"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC0212 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49832"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRW2"
FT                   /protein_id="ACF49832.1"
FT                   /translation="MSKPDPAMNALGVLALELAGGEIPRQAVLSAEQAGELAERVGRDL
FT                   AKQVPQVAELDLVFAAAHFDPAEVLRPGWPIHRRLEELQMRAPGRNQGPRLLAFGTDAT
FT                   GDVPLPFQADASLVGGGLRVVPFLLTGSDVATTNAVAEALEDTLLANGMAHADTALMAQ
FT                   NTFGARIEHARYFTVNDLAAMMSMQYDNQGLAALWPLIETAIMAPGEDEWLNAAPEPLL
FT                   RYTHGEARMALFDPAGWCAHYDHGNNDCDRLKGIYEQFLMRQRQMAAVLEAHGVPVLFV
FT                   HCEAGQDARELLAR"
     atgagcaaac ccgaccccgc gatgaatgcc cttggcgtgc tggccctgga actggccggc        60
     ggcgaaatcc cccgccaggc ggtgctcagc gccgaacagg ccggtgaact ggccgaacgc       120
     gtcggccgtg acctggccaa gcaagtgccg caggtggccg agctggacct ggtgttcgcc       180
     gccgcccatt tcgacccggc cgaagtgctg cgcccgggct ggccgatcca ccgccgcctg       240
     gaagaattgc agatgcgcgc accgggccgc aaccaggggc cgcgcctgct ggccttcggt       300
     accgacgcca ctggtgatgt gccgctgccg ttccaggccg atgccagcct ggtgggcggt       360
     ggcctgcgcg tggtgccgtt cctgctgacc ggcagcgacg tggccaccac caatgcggtg       420
     gccgaagcgc tggaagacac gctgctggcc aatggcatgg cccatgccga caccgcgctg       480
     atggcgcaga acacttttgg tgcgcgcatc gagcacgcgc gctacttcac cgtgaacgac       540
     ctggccgcga tgatgtcgat gcagtacgac aatcagggcc tggccgcact gtggccgctg       600
     atcgagaccg cgatcatggc gcccggcgaa gacgagtggc tcaacgccgc acccgagccg       660
     ctgctgcgct acacccatgg cgaggcacgc atggcgctgt tcgatccggc cggctggtgt       720
     gcgcattacg accacggcaa caacgactgc gaccgcctga agggcatcta cgagcagttc       780
     ctgatgcgcc agcggcagat ggcggcggtg ctggaagcgc acggcgtgcc ggtgctgttc       840
     gtgcactgcg aagccgggca ggacgcgcgc gagctgctgg cgcgctga                    888
//

If you have problems or comments...

PBIL Back to PBIL home page