(data stored in ACNUC7421 zone)

EMBL: CP001111.PE129

CP001111.PE129       Location/Qualifiers
FT   CDS_pept        complement(169716..171011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0129"
FT                   /product="HemY domain protein"
FT                   /note="PFAM: HemY domain protein; KEGG: xac:XAC0214
FT                   porphyrin biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49834"
FT                   /db_xref="GOA:B4SRW4"
FT                   /db_xref="InterPro:IPR005254"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRW4"
FT                   /protein_id="ACF49834.1"
FT                   /translation="MKPLQSLVVLLLAVAIGVVAAQWLGADDLNRFGEVTLRYGGYDYH
FT                   SNLPKVALLSVVAVLVLWLLWSLIAAPFRAWGRYRRKQGRVRLIDGLQAYEHGQWQRAE
FT                   KLLDGAAKDPEVSAVALANAVRSAQARADGAAGEALLQRLGESDATLQALLRAEQLLAR
FT                   DLPVDAINALDVAAIQPLPPRGLWLRTEALAQAGRAHEAYGQLGALRQSKVLPADANSE
FT                   LEARLAAQALLEAADVNALAAQWEATPKALRPTPDVVGAYASRAVALSWDEPALLALEH
FT                   ALDQRWDDELVALYGRLPAERLATRQANLARWRNVHDSSAALRLAQGRVALGQQQWDAA
FT                   DAFLHEAIAAGAGAPAWEALGELFAQRGDHALAAQCLANALRLQRGEDSVELVRGTEAP
FT                   LRATVEEQPVTVQPPVYDANEERDEFGNPRLP"
     atgaaacccc tgcaatccct ggtcgtgctg ttgctggccg tggccatcgg cgtggtcgcc        60
     gcgcaatggc tcggcgccga tgacctcaac cgcttcggcg aagtgaccct gcgctatggc       120
     ggctacgact atcacagcaa cctgccgaag gtggccctgc tgtccgtggt cgccgtgctg       180
     gtgctgtggc tgctgtggag cctgatcgcc gcaccgttcc gtgcctgggg ccgctaccgc       240
     cgcaagcagg gccgggtgcg cctgatcgac ggcctgcagg cctatgagca tggccagtgg       300
     cagcgcgcgg agaagctgct ggatggcgcg gcgaaggatc cggaagtgag cgcggtggcg       360
     ctggccaatg ccgtgcgcag tgcgcaggcg cgtgccgatg gtgctgccgg tgaagcgctg       420
     ctgcagcgcc tgggcgaaag cgatgccacc ctgcaggcgc tgctgcgcgc cgagcagctg       480
     ctggcgcgcg acctgccggt ggatgcgatc aacgcgttgg atgtggcggc gatccagccg       540
     ctgccgccgc gtggtctgtg gctgcgtacc gaagcgctgg cacaggccgg tcgcgcgcac       600
     gaggcatatg gccagctggg tgcactgcgc cagagcaagg tgctgccggc cgacgcgaac       660
     agcgaactgg aagcacgcct ggccgcacaa gcgctgctgg aagcggccga cgtcaatgca       720
     ttggccgcgc agtgggaagc cacgccgaag gccctgcgac cgaccccgga cgtggtcgga       780
     gcgtatgcca gccgtgcggt tgcgttgagc tgggacgaac cggcgctgct ggcgttggaa       840
     cacgccctgg accagcgctg ggacgatgag ctggtggcgc tgtacggccg cctgccggcc       900
     gagcgcctgg ccacccgcca ggccaatctg gcgcgctggc gcaacgtgca tgacagctcg       960
     gccgcgctgc gcctggcgca gggtcgcgtg gcgctgggcc agcagcagtg ggatgccgct      1020
     gatgcgttcc tgcacgaggc gatcgccgcc ggtgccggtg ccccggcctg ggaagcactg      1080
     ggtgaactgt tcgcacagcg tggcgaccac gcgctggccg cgcagtgcct ggccaatgcg      1140
     ctgcgcctgc agcgtggcga agacagcgtg gaactggtgc gcggcaccga ggcgccgctg      1200
     cgtgccacgg tggaggagca gccggttacg gtgcagccgc cggtgtatga cgccaacgaa      1260
     gagcgcgacg aattcggcaa cccgcggttg ccgtga                                1296
//

If you have problems or comments...

PBIL Back to PBIL home page