(data stored in ACNUC7421 zone)

EMBL: CP001111.PE13

CP001111.PE13        Location/Qualifiers
FT   CDS_pept        14922..15191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0013"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcv:XCV0014 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49718"
FT                   /db_xref="GOA:B4SR17"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR17"
FT                   /protein_id="ACF49718.1"
FT                   /translation="MYWLYLLLALGCFAFALKTPNAGLMTLCLLAALAFLLAWVRGRYV
FT                   ARFGDLQRDPATLVDAEELRRLREQAQARRSAAPDEHDPSPLSK"
     atgtactggt tgtacctgct gctggcgctg ggctgtttcg ccttcgccct gaagacgccc        60
     aatgccgggt tgatgaccct gtgcctgctg gccgccctcg ccttcctgct ggcctgggta       120
     cgcggccgct acgtggcacg cttcggcgac ctgcagcgtg atcccgctac cctggtcgac       180
     gccgaggaac tgcgccgcct gcgcgaacag gcccaggccc gtcgcagcgc cgcccccgac       240
     gaacacgatc cgtcccctct ttccaagtag                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page