(data stored in ACNUC7421 zone)

EMBL: CP001111.PE130

CP001111.PE130       Location/Qualifiers
FT   CDS_pept        complement(171018..171992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0130"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC0215 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49835"
FT                   /db_xref="GOA:B4SRW5"
FT                   /db_xref="InterPro:IPR007470"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRW5"
FT                   /protein_id="ACF49835.1"
FT                   /translation="MNETPPVSPPRRPVRWLLPLAGVVVLGVGGYAGWRFWHEQQDAQD
FT                   AQAQTTAVQLQGLEATLDALRRDQRATSQRLQDAAATNRVLRDEMLGLSQRSALLEENL
FT                   AKLADSANQGRQAVQRDEAELLLTQAAQRLNYSDDVEGARRLYAQAATALADLPDSDGL
FT                   NLRQALVQEREALDALGAGPRVQSLQRLDALAKALQGLPSQVTGSATANARPWWQATLA
FT                   PFVDITPSRQNGPLTAAERHNADDALQLELTLARAAIERGDRSGRDTALQRVEHWAQRR
FT                   WPDSPALRAQRAELKALRELPLQASNTVLGSTLQQLRTQTDRR"
     atgaacgaga ccccgcccgt ttccccgccc cgccgaccgg tgcgctggct gctgccgctg        60
     gccggcgtgg tcgtgcttgg cgtgggtggc tatgccggct ggcgcttctg gcatgagcaa       120
     caggacgcac aggacgcaca ggcacagacc accgccgtgc agctgcaggg cctggaagcc       180
     acactggatg ccctgcgccg cgaccagcgc gcgaccagcc aacgcctgca ggatgccgcc       240
     gccaccaacc gcgtgctgcg cgacgagatg ctgggccttt cgcagcgtag tgcgctgctg       300
     gaagaaaacc tggccaagct ggccgacagc gccaaccagg gccggcaggc agtgcagcgc       360
     gacgaggccg agctgctgct gacccaggct gcgcagcgcc tgaactactc tgacgatgtg       420
     gaaggtgcgc gtcgtctgta cgcgcaggct gccaccgcgc tggccgatct gcccgacagt       480
     gatggcctga acctgcgcca ggcactggtg caggagcgcg aggcgctgga cgcgctcggt       540
     gctggcccgc gcgtgcagtc gctgcagcgc ctggatgcat tggccaaggc attgcagggc       600
     ctgccttcgc aggtgacggg cagcgccacc gctaacgcca ggccctggtg gcaggccacg       660
     ctggcgccgt tcgtggatat caccccgagc cgccagaacg gccccctgac cgccgccgag       720
     cgccacaacg ccgacgatgc gctgcagctg gaactgaccc tggcgcgtgc agccattgaa       780
     cgtggcgacc gcagcggacg cgataccgcg ctgcagcgcg tggagcactg ggcacagcgg       840
     cgttggccgg attcaccggc cctgcgcgcg caacgtgctg aactgaaggc cttgcgcgag       900
     cttccgctgc aggccagcaa caccgttctt ggcagcaccc tgcagcaact gcgcacccag       960
     accgaccgga ggtaa                                                        975
//

If you have problems or comments...

PBIL Back to PBIL home page