(data stored in ACNUC7421 zone)

EMBL: CP001111.PE132

CP001111.PE132       Location/Qualifiers
FT   CDS_pept        172941..173408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0132"
FT                   /product="thioesterase domain protein"
FT                   /note="TIGRFAM: thioesterase domain protein; PFAM:
FT                   Thioesterase putative; KEGG: xac:XAC0218 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49837"
FT                   /db_xref="InterPro:IPR012660"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRW7"
FT                   /protein_id="ACF49837.1"
FT                   /translation="MSVDALTSSLAALQDVLDCMPAVRAMQIQLDGYADGVLRITAPLA
FT                   ANVNDKGNAFGGSLASVLTLSGWALVSLRLRLAGHDAEVYVADSNLRYLAPVYEDLHAH
FT                   AEAAEATGWDAFLNTFRQRRKARISIVATQPGADGKPAAEFSGRFVAFAKG"
     atgtccgttg atgctctgac ttcctcgttg gctgccctgc aggacgtgct ggactgcatg        60
     ccggcggtcc gcgccatgca gatccagctc gacggctatg ccgatggcgt gctgcgcatc       120
     accgcaccgc tggccgccaa cgtcaacgac aagggcaatg ccttcggcgg cagcctggcc       180
     tcggtgctga ccctgtccgg ctgggcgctg gtcagcctgc gcctgcgcct ggccggccac       240
     gacgccgagg tctacgtggc cgacagcaac ctgcgctacc tggcgccggt ctacgaagac       300
     ctgcacgccc atgccgaagc ggccgaggcc accggctggg acgccttcct gaacaccttc       360
     cgccagcgcc gcaaggcccg tatcagcatc gtcgccaccc agcccggtgc tgatggcaag       420
     cccgccgccg agttcagcgg ccgcttcgtg gccttcgcca aagggtag                    468
//

If you have problems or comments...

PBIL Back to PBIL home page