(data stored in ACNUC7421 zone)

EMBL: CP001111.PE134

CP001111.PE134       Location/Qualifiers
FT   CDS_pept        173924..174361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0134"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: xcb:XC_0212
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49839"
FT                   /db_xref="GOA:B4SRW9"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRW9"
FT                   /protein_id="ACF49839.1"
FT                   /translation="MNYEELLAFAGRNPMLSAALVGLTVAIIVTEIRRLFRGFKGIKPA
FT                   ELTQLINAGGTVVVDLSASGDFEKGHIAGSRNAQASAFGPDNKLVANAKQSPVVLVCRS
FT                   GNASETAAKALKKAGFEKVYVLDGGIPAWQQAELPLVKGRN"
     gtgaattacg aagagttgct ggcctttgca ggccgaaacc cgatgctgtc cgcggccctg        60
     gtcggcctga ccgtggccat catcgtcacc gagatccgcc gcctgttccg gggcttcaag       120
     ggcatcaagc ccgccgaact gacccagctg atcaatgcag gtggcacggt ggtggtcgac       180
     ctgtcggcca gcggtgactt cgagaagggc cacatcgccg gcagccgcaa tgcccaggcc       240
     agtgccttcg gcccggacaa caagctggtg gccaacgcca agcagtcgcc ggtggtgctg       300
     gtgtgccgca gtggcaacgc ctcggaaacc gccgccaagg cgctgaagaa ggccggcttc       360
     gagaaggtct acgtgctcga cggcggcatt cctgcctggc agcaggccga gctgccgctg       420
     gtcaagggcc gcaactga                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page