(data stored in ACNUC7421 zone)

EMBL: CP001111.PE137

CP001111.PE137       Location/Qualifiers
FT   CDS_pept        complement(176166..176642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0137"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cel:F09E10.7 F09E10.7a"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49842"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSG0"
FT                   /protein_id="ACF49842.1"
FT                   /translation="MRRTRLAVIFCSALLLAIPAIAHDAESTKAAQPLPDAALPATLDR
FT                   VLRDYEQAWRSGDAKALAALFAEDGFVLQSSQLPVRGRSAIEAAYSGQGGSPLRLRALA
FT                   YSVDGNTGYIIGAYRYGNNMGDTGKFTLTLKRVGDGPWLIFSDMDNGNAPPRAR"
     atgcgccgca cacgactcgc cgtgattttc tgcagtgccc tgctgctggc aattccagca        60
     atcgcccacg atgccgaaag cacgaaggcg gcacagccgc ttcccgatgc ggccctgccc       120
     gcgacactgg atcgcgtact gcgcgactac gagcaggcct ggcgcagcgg tgatgccaag       180
     gcactggctg cgctgttcgc cgaggatggc tttgtgctgc agagcagcca gctacccgtg       240
     cgtgggcgca gtgcaatcga agccgcgtat tccggccagg gtggcagccc gttgcggctg       300
     cgtgcgttgg cgtactcggt ggacgggaac acgggctaca tcattggtgc ctaccgctac       360
     ggcaacaaca tgggggacac cggcaaattc acgctgacgc tgaagcgcgt gggcgatgga       420
     ccgtggttga tcttctcgga catggacaac ggcaacgcgc cgccacgggc gcggtga          477
//

If you have problems or comments...

PBIL Back to PBIL home page