(data stored in ACNUC7421 zone)

EMBL: CP001111.PE14

CP001111.PE14        Location/Qualifiers
FT   CDS_pept        15201..15944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0014"
FT                   /product="Pyridoxal phosphate biosynthetic protein PdxJ"
FT                   /note="PFAM: Pyridoxal phosphate biosynthetic protein PdxJ;
FT                   KEGG: xcb:XC_0012 pyridoxal phosphate biosynthetic protein
FT                   PdxJ"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49719"
FT                   /db_xref="GOA:B4SR18"
FT                   /db_xref="InterPro:IPR004569"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036130"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR18"
FT                   /protein_id="ACF49719.1"
FT                   /translation="MTQLSVNVNKIAVLRNSRGGAEPDVVRAAQACLDAGAHGITVHPR
FT                   PDRRHITAEDVLALSTLTRARGVEFNIEGNPFAPPREGYPGLLPLCAQTRPAQATLVPD
FT                   SDGQITSDHGFDFERDAERLRPLIAELKAMGCRVSLFVDAGNPLLEQAAEVGADRIELY
FT                   TGPYAEAHAAGDAGAMLTLFATAARRAQAVGLGVNAGHDLSQDNLRDFLANVPDVLEVS
FT                   IGHALIGEALYDGLDATVRGYLALL"
     atgacccagc tcagcgtcaa cgtcaacaag atcgccgtcc tgcgcaattc gcgcggcggt        60
     gccgaaccgg acgtggtgcg tgcggcccag gcctgcctgg atgccggcgc gcatggcatc       120
     accgtgcacc cgcggccgga ccgccgccac atcaccgccg aggacgtgct ggccctgtcc       180
     acgctgaccc gtgcgcgtgg ggtggagttc aacatcgaag gcaatccgtt cgcaccaccg       240
     cgcgagggtt atccggggct gctgccgctg tgtgcacaga cccgtccggc gcaggctacc       300
     ctggtgccgg acagcgacgg ccagatcacc tccgatcatg gcttcgactt cgagcgcgat       360
     gccgagcgcc tgcgcccgct gatcgccgaa ctgaaggcga tgggttgccg ggtcagtctg       420
     ttcgtcgacg ccggcaaccc gttgctggag caggcggccg aggtcggtgc cgaccgcatc       480
     gagctgtaca ccggccccta cgccgaagcg catgcggcgg gcgatgccgg cgcgatgctg       540
     acgctctttg ccaccgctgc ccgtcgagcg caggccgtcg gactgggcgt caacgccgga       600
     cacgacctgt cgcaggacaa cctgcgtgat ttcctggcca acgtgccgga cgtgctggag       660
     gtgtcgatcg gccacgcgct gatcggtgag gccctgtacg acgggctgga tgccacggtg       720
     cgcgggtact tggcgctgct ctga                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page