(data stored in ACNUC7421 zone)
EMBL: CP001111.PE140
CP001111.PE140 Location/Qualifiers
FT CDS_pept complement(178843..179106)
FT /codon_start=1
FT /transl_table=11
FT /locus_tag="Smal_0140"
FT /product="helix-turn-helix domain protein"
FT /note="PFAM: helix-turn-helix domain protein; KEGG:
FT reu:Reut_A1911 putative transcription regulator protein"
FT /db_xref="EnsemblGenomes-Gn:Smal_0140"
FT /db_xref="EnsemblGenomes-Tr:ACF49845"
FT /db_xref="GOA:B4SSG3"
FT /db_xref="InterPro:IPR001387"
FT /db_xref="InterPro:IPR010982"
FT /db_xref="UniProtKB/TrEMBL:B4SSG3"
FT /protein_id="ACF49845.1"
FT /translation="MKIRLEKAEALGPLVRAARKHQGLRQDATAEGIGVSENFLAKVER
FT GGTTVQWGKLFTVLDELGLHVEIDVPDEAMALLAKRANGKAP"
ttgaagatca ggcttgagaa ggctgaggcc ttgggaccac tggtgagagc cgcccgcaag 60
catcagggac tgcgccagga tgcaaccgcc gaaggcatcg gggtcagcga gaatttcctg 120
gccaaggtcg aacgcggcgg taccacggtg caatggggca agttgttcac cgtgcttgac 180
gagctggggc tgcatgtcga aatcgacgtg ccggacgaag cgatggccct gctggccaaa 240
cgtgccaacg ggaaggcgcc atga 264
//
If you have problems or comments...
Back to PBIL home page