(data stored in ACNUC7421 zone)

EMBL: CP001111.PE140

CP001111.PE140       Location/Qualifiers
FT   CDS_pept        complement(178843..179106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0140"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   reu:Reut_A1911 putative transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49845"
FT                   /db_xref="GOA:B4SSG3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSG3"
FT                   /protein_id="ACF49845.1"
FT                   /translation="MKIRLEKAEALGPLVRAARKHQGLRQDATAEGIGVSENFLAKVER
FT                   GGTTVQWGKLFTVLDELGLHVEIDVPDEAMALLAKRANGKAP"
     ttgaagatca ggcttgagaa ggctgaggcc ttgggaccac tggtgagagc cgcccgcaag        60
     catcagggac tgcgccagga tgcaaccgcc gaaggcatcg gggtcagcga gaatttcctg       120
     gccaaggtcg aacgcggcgg taccacggtg caatggggca agttgttcac cgtgcttgac       180
     gagctggggc tgcatgtcga aatcgacgtg ccggacgaag cgatggccct gctggccaaa       240
     cgtgccaacg ggaaggcgcc atga                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page