(data stored in ACNUC7421 zone)

EMBL: CP001111.PE144

CP001111.PE144       Location/Qualifiers
FT   CDS_pept        182025..182600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0144"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xom:XOO_3968 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49849"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR026364"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSG7"
FT                   /protein_id="ACF49849.1"
FT                   /translation="MNKNSLLALGLLAALPFAASATDGLSYNYVEGGYVNTDAKGGDAD
FT                   GWKVKGSVAVHPNFHVFGDYSAQETDKFKNDVDQWRLGVGYNYGIAPNTDLVARVAYQK
FT                   YDEKRGLDFNGYSTEVGVRTAFNPYVEGYVMAGYEDFSKKHGYNPDGEFYGRVGATAKF
FT                   NQNWGLSGEVKLAKAGDREWFVGPRFTW"
     atgaacaaga attcgctgct tgccctgggt cttctggctg ctctgccgtt cgctgcatcg        60
     gcaaccgatg gcctgtcgta caactacgtt gaaggcggct acgtgaacac cgatgccaag       120
     ggcggcgacg ccgatggctg gaaggtgaag ggttccgttg cggtgcaccc gaacttccac       180
     gtctttggcg actacagcgc ccaggagacc gacaagttca agaatgacgt cgaccagtgg       240
     cgcctgggtg tcggctacaa ctacggcatc gcaccgaaca ccgacctggt ggctcgcgtt       300
     gcctaccaga agtacgacga gaagcgcggc ctggacttca acggctactc caccgaagtg       360
     ggcgtgcgca ccgcgttcaa cccgtacgtg gaaggctacg tgatggccgg ctacgaagat       420
     ttcagcaaga agcacggcta caacccggac ggcgagttct acggccgcgt cggcgccacc       480
     gccaagttca accagaactg gggcctgagt ggcgaagtga agctggccaa ggccggcgac       540
     cgcgagtggt tcgtgggccc gcgcttcacc tggtaa                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page