(data stored in ACNUC7421 zone)

EMBL: CP001111.PE146

CP001111.PE146       Location/Qualifiers
FT   CDS_pept        183558..183926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0146"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: atc:AGR_C_2825 conserved
FT                   hypothetical protein VCA0415"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49851"
FT                   /db_xref="GOA:B4SSG9"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSG9"
FT                   /protein_id="ACF49851.1"
FT                   /translation="MSHAAPPDAERRIDNIEFNVADIARSKRFYGEVFGWNFTDYGPAY
FT                   TEFDDGRLKGGLVSDTPVRAQGSPLVILYCADLADAQQRVIAAGGEVVQAVFAFPGGRR
FT                   FHFRDLDGYELAVWSDVD"
     atgagccacg ccgcaccccc cgatgccgaa cgccgcatcg acaacatcga attcaacgtc        60
     gccgacatcg cccgcagcaa acgcttctac ggcgaggtgt tcggctggaa tttcacggac       120
     tacggcccgg cctacaccga gttcgacgac ggccgcctga aaggcggctt ggtgtccgac       180
     acaccggtac gtgcgcaggg cagcccactg gtgattctct actgcgcgga ccttgccgac       240
     gcccagcagc gcgtgatcgc cgccggtggc gaggtggtgc aggcggtgtt cgccttcccc       300
     ggtggccgtc gcttccactt ccgcgatctg gatggctacg agctggcggt ctggagtgat       360
     gtggattga                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page