(data stored in ACNUC7421 zone)

EMBL: CP001111.PE150

CP001111.PE150       Location/Qualifiers
FT   CDS_pept        complement(186213..188402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0150"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="TIGRFAM: TonB-dependent siderophore receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor plug;
FT                   KEGG: xcc:XCC0674 putative siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49855"
FT                   /db_xref="GOA:B4SSH3"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR030149"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSH3"
FT                   /protein_id="ACF49855.1"
FT                   /translation="MNRCLRPNLLSLALCAALPLHASEADASPDAAATGAERSPTELAA
FT                   VRVQAGKPKADTSRVNAFGGGSWKETPASVNVLERDYLDRRQVRSLSELASNDASLGDA
FT                   YAPVGYYQNIAIRGFALDAATGYRFNGLSIAGEQRLALENVQSVEILKGEAGLAAGVMA
FT                   PGGIINYIGKRPAEVRTVTLGTDSEGSRYAAVDVGHWITPRFGLRLNAAWDASNSYVEH
FT                   ADGRRNFYSLAADWLIGERGKLEVDANYQTSSQRSVSGYQLLGARELPHGVDREFLLGY
FT                   QPWQRPVDIASTNITALHTYDFNDAWQSRVSVGHSRSVIDDNVAFAYGCYYATQCADGS
FT                   VPGNYFAPNGDYDVYDYRSPDDTRRNQQARAELRGRFETGSVGHQLTLGADYFRRTVDK
FT                   RPSVNEYVGTSNIHDAQVPVFEPSPKMPGPSARRLDSRQTAFFALDRMSFGDDWQWLAG
FT                   GRFVRLDERAYDKRGTPQRHSRLSRFLPQTAVVWKATDQLNAYASYVRGISLGQEAPFW
FT                   TSNADTFLPSVQSRQLEVGVKYVPVEALTLGAAVFRISQPYQYAKPDSSDVGYTFVEEG
FT                   TQTHTGLELTANGQLTDALQIVASASVLQARARDTGTPAYEGHQLVNVPKVRASVHVAY
FT                   ALPFVQGLDVTGGWRYAGANVARADGGVRAPDYSVFDAGLRFQHRLHERAVTWNLSVDN
FT                   VFNRFYWRDTGSSGGDYYLFPGAPRQARLSVTFAL"
     atgaaccgct gcctgcgccc caacctgctc tccctcgccc tctgcgccgc gctgccgctg        60
     catgccagcg aggccgatgc atctcccgat gcggctgcca ctggtgccga acgctcgccg       120
     accgaactgg cggcagtgcg cgtgcaggcc ggcaagccga aggccgatac ctcgcgcgtg       180
     aacgccttcg gtggtggttc ctggaaggag acgccggcgt cggtgaacgt gcttgagcgc       240
     gactacctcg accgccgcca ggtgcgttcg ctgtccgagc tggccagcaa cgatgcctcg       300
     ctgggcgatg cgtacgcgcc ggtcggctac taccagaaca tcgccatccg tggcttcgcg       360
     ctggacgccg ccaccggcta ccgcttcaac ggcctgtcca tcgccggcga acagcgcctg       420
     gcgctggaga acgtgcagtc ggttgagatc ctcaagggtg aagctggcct ggctgcaggc       480
     gtgatggcac ccggcggcat catcaactac atcggcaagc gaccggccga agtgcgcacg       540
     gtcaccctcg gcaccgattc ggaaggctcg cgctacgccg ccgtcgatgt cggccactgg       600
     atcaccccgc gtttcggcct gcgcctgaat gccgcatggg atgccagcaa ttcctatgtc       660
     gagcacgccg atggccgtcg caacttctat tcgctggccg ccgactggct gatcggcgaa       720
     cgcggcaagc tggaagtgga tgccaactac cagaccagtt cgcagcgctc ggtgtcgggc       780
     taccagctgc tgggcgcgcg cgagctgccg cacggcgtgg atcgcgaatt cctgctcggc       840
     taccagccgt ggcagcgccc ggtggatatc gccagcacca acatcaccgc gttgcacacc       900
     tacgacttca acgatgcctg gcagtcgcgc gtctcggtcg gccacagccg ctcggtgatc       960
     gatgacaacg tcgccttcgc ctatggctgc tactacgcca cgcagtgcgc cgatggcagc      1020
     gtgccgggca actacttcgc gcccaatggc gactacgacg tctacgacta ccgcagcccg      1080
     gacgacaccc gccgcaacca gcaggcccgt gccgagctgc gtggccgctt cgagaccggc      1140
     agcgtcggcc accagctgac cctcggtgcc gattacttcc gccgcaccgt ggacaagcgc      1200
     ccgagcgtca acgagtacgt cggcaccagc aacatccacg atgcgcaggt accggtgttc      1260
     gaaccgtcgc cgaagatgcc cggcccctcc gcacgacgcc tggacagccg ccagaccgcg      1320
     ttcttcgcgc tggaccggat gagcttcggt gatgactggc agtggctggc cggcggccgc      1380
     ttcgtgcgcc tggacgagcg tgcctacgac aagcgtggta ccccgcagcg gcacagccgc      1440
     ctgtcgcgtt tcctgccgca gaccgccgtg gtgtggaagg ccaccgatca gctcaatgcc      1500
     tatgccagct atgtgcgcgg catctcgctg ggccaggaag cgccgttctg gaccagcaat      1560
     gccgacacct tcctgccatc ggtgcagtcg cgccagctgg aagtgggcgt gaagtacgtg      1620
     ccggtcgagg cgctgacgct gggcgcagcc gtgttccgca tctcgcagcc gtaccagtac      1680
     gccaagccgg acagcagcga cgtcggctac accttcgtcg aggaaggcac gcagacccac      1740
     accggcctgg agctgactgc caacgggcag ctgacagacg cgctgcagat cgtggccagc      1800
     gccagcgtgc tgcaggcgcg cgcgcgcgac accggcaccc cggcctatga aggccatcag      1860
     ttggtgaatg tgccaaaggt gcgcgccagc gtgcacgtgg cctatgcgct cccgttcgtg      1920
     cagggcctgg atgtgaccgg cggctggcgc tatgccggtg ccaacgtggc acgcgccgac      1980
     ggtggtgtac gcgcaccgga ctactcggtg ttcgatgccg gcctgcgctt ccagcaccgc      2040
     ctgcacgaac gtgcggtgac ctggaacctg tcggtggata acgtgttcaa ccgcttctac      2100
     tggcgcgata ccggcagcag tggtggtgac tactacctgt tccccggcgc accgcgacag      2160
     gcccgcctgt cggtgacgtt cgcactgtga                                       2190
//

If you have problems or comments...

PBIL Back to PBIL home page