(data stored in ACNUC7421 zone)

EMBL: CP001111.PE151

CP001111.PE151       Location/Qualifiers
FT   CDS_pept        complement(188678..189802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0151"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   xac:XAC3528 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49856"
FT                   /db_xref="GOA:B4SSH4"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSH4"
FT                   /protein_id="ACF49856.1"
FT                   /translation="MTSSSHRVQGLNNDEVAADWPPISAADLAWLRQRFPQLDADSHPH
FT                   WHSPRPLSAAAIVNGTRGPVFIKRHHHSVRSAACLEEEHHFIAHLAAAGVPVVQVLAAA
FT                   DGHTAVEHGEWTFELHAVGVGEDLYRDAASWSLLTDVAQAREAGRMLAELHRAAASYHA
FT                   PQRSTHLLVARDDLIRADDPIAAIKAGLHERSGLARYLARIPWEAQLQRDVLPWHAGLA
FT                   ERLRDEPRLWAHNDWHVSNLLWRDGQVSTVLDFGLASPTSALFDLATAIERNAVAWLEL
FT                   ERGMEAVRIDIALALIDGYRKVLPLSAARVQLLADLLPMVHFDFALSEVEYFEGITGST
FT                   ANADVAWQPFMLGHPAWFHSAPGQALLQALRAAA"
     atgacttctt cctcccaccg cgtgcagggc ctcaacaacg acgaggttgc tgccgactgg        60
     ccgccgatca gcgccgcaga cctcgcgtgg ctgcgccagc gctttccgca gctggatgcg       120
     gacagccacc cgcactggca cagtcctcgg ccactgtcgg ccgctgccat cgtcaatggc       180
     acgcgcggac cggtgttcat caagcgccac caccacagcg tgcgcagcgc cgcctgcctg       240
     gaagaagaac accacttcat cgcccatctc gctgccgccg gcgtaccggt tgtgcaggtg       300
     ctggcggcag ccgatggcca caccgcggtc gagcacggcg aatggacctt cgagctgcat       360
     gccgtgggcg tgggcgagga cctgtaccgc gatgccgcgt cgtggtcgtt gctgaccgat       420
     gtcgcgcagg cccgcgaagc cggccgcatg ctggccgagc tgcaccgtgc cgccgccagc       480
     tatcacgcgc cacagcgcag tacccatctg ctggttgcac gcgacgacct gatccgcgcc       540
     gacgatccga tcgcggccat caaggcgggg ctgcacgagc gctccgggct ggcccgctac       600
     ctcgcgcgca ttccgtggga ggcgcagctg cagcgcgacg tgctgccgtg gcatgccggc       660
     ctggccgagc gcctgcgcga cgaaccgcga ctatgggcgc acaacgactg gcatgtctcc       720
     aacctgctgt ggcgcgatgg acaggtcagc accgtgctgg atttcggcct ggcctcgccc       780
     accagcgccc tgttcgacct cgccaccgcg atcgagcgca acgcagtggc gtggctggaa       840
     ctggagcgcg gcatggaggc ggtgcgcatc gatatcgcgc tggccctgat cgacggctac       900
     cgcaaggtgc tgccattgtc ggcagcacgc gtgcagctgc tggccgacct gctgccgatg       960
     gtgcatttcg acttcgcact atccgaagtg gagtatttcg aaggcatcac cggctccacc      1020
     gcaaacgcgg atgtggcctg gcagccgttc atgctggggc acccggcgtg gttccacagc      1080
     gcgccgggac aggcactgct gcaggcgttg cgcgcagccg cgtga                      1125
//

If you have problems or comments...

PBIL Back to PBIL home page