(data stored in ACNUC7421 zone)

EMBL: CP001111.PE155

CP001111.PE155       Location/Qualifiers
FT   CDS_pept        complement(193846..194484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0155"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; KEGG: pfl:PFL_1107 DNA-binding response
FT                   regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49860"
FT                   /db_xref="GOA:B4SSH8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSH8"
FT                   /protein_id="ACF49860.1"
FT                   /translation="MSLRIIIADDHPVVRIGTRAVIESSGVGRVVGEADSAQALMTLLG
FT                   SQPCDLLVTDYSMPGSPQADGFAMIGMIRRRHPDLPVLMLSVSNNLAILRMVLDSGVLG
FT                   LVDKSSSMDELPQAIQAVYRGQPYISRSLRERVEAAGSWRMREGDGKPLSPREVEVLRL
FT                   LGTGMTVKEISLQLHKSVSTISRQKGDAMLKLGLKGDAELFDYLRDGKI"
     atgagcttgc gcatcatcat cgcagacgac cacccggtgg tccgtatcgg tacccgtgcc        60
     gtcatcgaat cgagcggggt gggccgcgtg gtcggcgaag ccgacagcgc gcaggcgctg       120
     atgaccctgc tcggcagcca accctgcgac ctgctggtca ccgactactc gatgccgggc       180
     agtccccagg ccgacggctt cgccatgatc ggcatgatcc gccgccgcca tcccgacctg       240
     ccggtactca tgctcagcgt ctccaacaac ctggcgatcc tgcgcatggt gctcgacagc       300
     ggcgtgctcg gcctggtcga caagagctcg tcgatggacg aactgccgca ggccatccag       360
     gcggtctatc gcggccagcc ctatatcagc cgcagcctgc gcgagcgggt cgaggccgcc       420
     ggcagctggc gcatgcgcga gggcgacggc aagccactgt cgccgcgcga ggtggaggtg       480
     ctgcggctgc tgggcaccgg catgaccgtg aaggaaatct cgctgcagct gcacaagagc       540
     gtcagcacca tcagccggca gaagggtgac gccatgctca aactgggcct gaagggcgac       600
     gccgagctgt tcgactacct gcgcgacggc aagatctga                              639
//

If you have problems or comments...

PBIL Back to PBIL home page