(data stored in ACNUC7421 zone)

EMBL: CP001111.PE156

CP001111.PE156       Location/Qualifiers
FT   CDS_pept        194560..198159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0156"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; Hpt domain protein; PAS fold-3 domain protein;
FT                   SMART: extracellular solute-binding protein family 3; KEGG:
FT                   pen:PSEEN3768 two-component sensor/response regulator
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49861"
FT                   /db_xref="GOA:B4SSH9"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSH9"
FT                   /protein_id="ACF49861.1"
FT                   /translation="MRSWAVRGLVLLLAVLVLPAAPVQAVPGLLPLTPLQREYLAAHPS
FT                   IVVGQYDSGWPPFESLRDGQQVGLGPDYLSLLARQLGVKVEARRYPDWTSVLDAACRGE
FT                   IDVVMNVGLSADRTRCMVYTAAYGEAPLALVGRPDDLRASDIPDLDGLRVVIEQDFLTG
FT                   PQVRARFPRARQLVANSSLTALQMVRDDKADVYIGNAYVATELIASQRLQGVVLLRPSD
FT                   LPPEQLHFGIPNSKQPLAEALDLALAATSQAQCDALVQRWLPLPQWSASARLALSQAEK
FT                   RVLEQPLKIGFAPNAAPLSFADKEGKPSGLASEYLRRLLQAGANLQPENSHDWYEVREK
FT                   ARRGELQAVMGIPADSRYLGPDWVFSQPFISVPNVIVSRVDSPALLGLSDLQGKRVLLS
FT                   DPERIRGYVLQQAPSARIIAARSAEQALQRLAAGEADAYVGNLALVDHLLRSSFPGRLQ
FT                   VAAPAGFNDQLVLAVERRHAALATTFDRLLLQMTPRKREALRGDWLAVEYRNGIDWRHA
FT                   LRWGLPLLLVLLTALLVHGIGYWRLRREVAGRRHLEQRLAEVTDNLPAVVYQARRDADG
FT                   TLGFPFIAGDLQALFGITRQQAEQDAKLLLERIEEEDRERILQAVEQAARQFAPLILEF
FT                   RLRADAGGARWVRSQAHPYAAEAGAVTWSGYWVDVSEARAQAEALTAAKAEAEQAAEAK
FT                   SRFLATMSHEIRTPMSGVLGMLEVLAHSPLDAEQQRILGVIEDSAQMLRQILDDILDYS
FT                   RLEAGALRLEPVPQPLRPLLESVCRLLSAQASARGLALLVEIDPQLAPAHEVDGVRLRQ
FT                   IVFNLLSNAIKFTARGEVRLQLEVLGPTAEDGSQPLCLSVTDTGMGIAPEQLQHLFAPF
FT                   TQAGAYIQRDHGGTGLGLSISQRLVQMMDGELTLHSTLGEGTRAEVRLSLVEAGSGDVE
FT                   ALVAEQEQASLLPPALRQARVLVIEDHPTNQAMMAWRLQQLGVPHVMVGDGQQGLDRLL
FT                   SESFDLVITDCRMPVLDGFGFTRLLREREGRNGQPRLTVLALTASVLDDDARRCREAGM
FT                   DEVLAKPLSLATLRAALLRWLPQAQGQSFAEPVTEVVADDGMALPDLSTLQQRFGSRAV
FT                   AIQLRDSLLQASEGDLAAVQRALQAGDREAAALHLHRQAGGLGAIGATVLAGQANALVE
FT                   RLQDAAETDPAPVFASVAEFVARLQQQLQRLAH"
     atgcgtagct gggctgttcg cgggctggtc ctgctgctgg ccgtgctggt gctgcctgcc        60
     gcaccggtac aggccgtgcc aggactgctg ccgctcactc ccctgcagcg cgagtacctg       120
     gccgcgcatc caagcatcgt cgtgggccag tatgacagcg gctggccgcc gttcgagtcc       180
     ctccgtgatg gccagcaggt cggcctgggg ccggattatc tgtcgcttct cgcccgtcag       240
     ctgggcgtga aggtcgaggc acggcgctat ccagactgga catccgtgct ggatgcggca       300
     tgtcgtggcg agatcgatgt agtgatgaat gtcggtctca gtgccgaccg cacccgctgc       360
     atggtctaca ccgccgccta tggcgaggca ccgctggccc tggtgggacg cccggatgac       420
     ctgcgtgcct ccgacatccc cgacctggat gggctgcggg tggtgatcga gcaggacttc       480
     ctgaccggcc cgcaggtgcg ggcgcgcttt ccccgggcac gacagcttgt cgcaaacagc       540
     tcgcttacgg cgctgcagat ggtcagagac gacaaagctg acgtttacat cggcaatgcc       600
     tatgtcgcca ccgagctgat cgccagccag cgcctgcagg gcgtggtgct gctgcgcccc       660
     agtgacctgc cgcccgagca actgcacttc ggcataccca acagcaagca gccactggcc       720
     gaagcactgg atctggctct ggctgcgacc agccaggcgc agtgtgatgc gctggtgcaa       780
     cgctggctgc cgttgccaca gtggtcggca tcggcacggc tggcgctgag tcaggccgag       840
     aagcgggtgc tggagcagcc gctgaagatc ggcttcgcgc cgaacgcggc gccgttgtcg       900
     ttcgccgaca aggaaggcaa gcccagtggc ctggccagcg agtatctgcg acggctgctg       960
     caggccggtg ccaatcttca gccggagaac agccacgact ggtatgaggt gcgcgagaag      1020
     gcgcgccgcg gcgagctgca ggcggtgatg ggcattcctg ccgattcgcg ctatctgggg      1080
     ccggactggg tgttcagcca gcccttcatc agcgtgccga acgtgatcgt cagccgcgtc      1140
     gacagcccgg cgctgctggg cctgtcggac ctgcagggca agcgcgtgct gctgtccgat      1200
     cccgagcgca tacgcggcta cgtgctgcag caggccccca gcgcacggat catcgccgcg      1260
     cgcagtgccg agcaggcgct gcagcgtctt gccgctggtg aagccgatgc ctacgtgggc      1320
     aacctggcac tggtcgatca cctgctgcgc agcagcttcc cggggcgcct gcaggtggcc      1380
     gccccggccg gcttcaacga ccagctggtg ctggccgtgg aacgccgcca tgcggccctg      1440
     gccaccacct tcgaccgcct gctgctgcag atgacgccgc gcaagcgtga agcgttgcgt      1500
     ggcgactggc tggcggtgga gtaccgcaat ggcatcgact ggaggcacgc gctgcgctgg      1560
     ggcctgccac tactgctggt attgctgact gccctgctgg tgcacggcat cgggtactgg      1620
     cgcctgcgtc gcgaggtggc cgggcggcgt catctggagc agcgcctggc cgaggtcacc      1680
     gacaaccttc ccgccgtggt ctaccaggca cggcgcgatg ccgatggcac tctcggtttt      1740
     ccgttcattg ccggcgacct gcaggcgctg ttcggcatca cccggcagca ggccgagcag      1800
     gacgcgaaac tgctgctgga acgcatcgag gaggaggatc gcgaacgcat cctgcaggcg      1860
     gtcgagcagg ccgcacgcca gttcgcgccg ctgatcctcg agttccgcct gcgtgccgat      1920
     gcgggcggtg cgcgctgggt gcgcagccag gcccatccct atgcggcaga ggcaggggcg      1980
     gtgacctgga gtggctactg ggtggacgtc agcgaggcac gtgcgcaggc cgaggccctg      2040
     accgcggcca aagccgaggc cgagcaggcg gcggaagcga agtcacgctt cctggccacg      2100
     atgagccatg agatccgtac accgatgagt ggcgtgctgg gcatgctgga agtactggcg      2160
     cattcgccgc tggatgccga gcagcagcgc atcctcggcg tgatcgagga ttcggcgcag      2220
     atgctgcggc agatcctgga tgacattctt gattactcgc gactggaggc cggtgcgctg      2280
     cgcctggagc cggtaccgca accgctgcgg ccgctgctgg aaagcgtatg ccggttgttg      2340
     tcggcgcagg ccagtgcacg cgggctggcg ttgctggtgg agatcgatcc acagctggca      2400
     ccggcacacg aagtggatgg cgtgcgcctg cgccagatcg tgttcaacct gctcagcaac      2460
     gccatcaagt tcacggcgcg cggcgaagtg cggctgcagc tggaggtgct ggggcctacc      2520
     gccgaggatg gcagccagcc gctgtgcctg agcgtgaccg acaccggcat gggcatcgca      2580
     ccggagcagc tgcagcatct gttcgcgccg ttcacccagg ccggtgccta catccagcgc      2640
     gaccatggtg gcaccggcct tggcctgagc atcagccagc gcctggtgca gatgatggac      2700
     ggcgaactga ccctgcacag cacgctgggc gaaggcaccc gcgccgaagt gcggttgtcg      2760
     ctggtggagg ccggcagcgg tgatgttgaa gcgctggtgg ccgagcagga acaggcctcg      2820
     ctgctgcccc cggcgctgcg ccaggcgcgg gtgctggtga tcgaggacca cccgaccaac      2880
     caggcgatga tggcctggcg cctgcagcag ctgggcgtgc cgcacgtgat ggtcggtgat      2940
     ggccagcagg ggctggatcg gctgttgtcg gaaagcttcg acctggtgat caccgattgc      3000
     cggatgccgg tgctcgatgg cttcggcttc acccggctgc tgcgcgagcg cgagggccgc      3060
     aatggccagc cgcggctgac cgtgctggcg ctgaccgcca gtgtgctgga cgacgatgcg      3120
     cgccgttgcc gcgaggccgg catggacgag gtactggcca agccgctgtc actggccacg      3180
     ttgcgcgcgg cgctgctgcg ttggttgccg caggcacagg gccagtcgtt cgccgaaccg      3240
     gtgacggagg tggttgccga cgacggcatg gcgctgccgg atctgtccac gttgcagcag      3300
     cgcttcggct cacgcgcggt ggcgatccag ctgcgcgaca gcctgctgca ggccagcgaa      3360
     ggcgatcttg ccgccgtgca gcgcgcgctg caggccggag atcgagaggc ggccgcgctg      3420
     cacctgcacc ggcaggccgg tggcctgggt gcaataggcg cgacggtgct ggccgggcag      3480
     gccaatgcgc tggtggagcg cctgcaggat gcggccgaga ccgatccggc gccggtgttc      3540
     gcaagcgtgg ccgaattcgt ggcgcggctg cagcagcaac tgcagcgcct tgctcactga      3600
//

If you have problems or comments...

PBIL Back to PBIL home page