(data stored in ACNUC7421 zone)

EMBL: CP001111.PE159

CP001111.PE159       Location/Qualifiers
FT   CDS_pept        200583..201776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0159"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: xcb:XC_2809
FT                   glutaryl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49864"
FT                   /db_xref="GOA:B4SSI2"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSI2"
FT                   /protein_id="ACF49864.1"
FT                   /translation="MSGSRLRVSAMALDPYDLFDVRSLLSEEERAVQESVARFTDERVL
FT                   PIIGDAFDQARFPSELVPEIASLGLLGATLPGEYGGGDLGAVSYGLICQELERGDSGLR
FT                   SFVSVQSSLCMYPIYAYGSEEQRRQWLPAMARGELIGCFGLTEAHGGSDPASMKTRAVR
FT                   DGDDWRINGSKMWITSGPVADLAIVWAQTEDGIQGFVLEKGMPGFTTQEIKHKMSLRAS
FT                   LTGALFFDDVRVPDSHRLPNVKGLKGPLGCLTQARFGISWGPIGSAIACLDEALGYAKE
FT                   RVLFGRPLAATQSAQIKLAEMARRITMAQLLALQLGRLKEAGQLQPQQVSLAKWNNCRM
FT                   AIDIARECRDLLGGAGITTEHVAIRHALNLESVITYEGTETVHQLVIGRELTGINAF"
     atgtccgggt cccgactgcg tgtgagtgcc atggctttgg atccgtacga cctgttcgat        60
     gtccgttccc tgctcagcga ggaagagcgc gcggtgcagg agagcgtggc ccgcttcacc       120
     gacgagcgcg tgctgccgat catcggcgat gccttcgacc aggcgcgctt cccgtcggaa       180
     ctggtgcctg agatcgcctc cttgggcctg ctcggtgcga ccctgcccgg cgaatacggc       240
     ggtggcgacc tcggcgcggt cagttacggc ctgatctgcc aggagctgga acgcggcgac       300
     tcaggcctgc gtagtttcgt gtcggtgcag agctcactgt gcatgtaccc gatctacgcc       360
     tacggcagtg aagaacagcg ccggcagtgg ctgccggcga tggcgcgcgg tgagctgatc       420
     ggctgcttcg gcctgaccga ggcgcatggc ggttccgatc cggccagcat gaagacccgc       480
     gcggtgcgcg atggcgacga ctggcgcatc aacggcagca agatgtggat caccagcggc       540
     ccggtggccg acctggccat cgtctgggcg cagaccgagg acggcatcca gggcttcgtg       600
     ctggaaaagg gcatgccggg gttcaccacg caggagatca agcacaagat gagcctgcgt       660
     gcgtcgctga ccggtgcgct gttcttcgac gacgtgcgcg tgcccgacag ccatcgcctg       720
     cccaacgtga agggcctgaa gggaccgctg ggttgcctga cccaggcgcg tttcggcatc       780
     agctgggggc cgatcggttc ggccattgcc tgcctggacg aagcgctggg ctatgccaag       840
     gagcgcgtgt tgttcggccg cccgctggcc gccacgcaga gcgcacagat caagctggcc       900
     gagatggcac gccgcatcac catggcgcag ctgctggcgt tgcagctcgg acgcctgaag       960
     gaagccggcc agctgcagcc acagcaggtg agcctggcca agtggaacaa ctgccgcatg      1020
     gcgatcgaca tcgcccgcga atgtcgcgat ctgctgggcg gcgccggcat caccaccgag      1080
     catgtagcga tccggcatgc gctgaacctg gaatcggtga tcacctatga aggcaccgag      1140
     accgtgcacc agctggtgat cggccgcgag ctgaccggca tcaacgcgtt ctga            1194
//

If you have problems or comments...

PBIL Back to PBIL home page