(data stored in ACNUC7421 zone)

EMBL: CP001111.PE16

CP001111.PE16        Location/Qualifiers
FT   CDS_pept        17350..20574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0016"
FT                   /product="YD repeat protein"
FT                   /note="TIGRFAM: YD repeat protein; PFAM: YD
FT                   repeat-containing protein; KEGG: xac:XAC1305
FT                   wall-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49721"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR20"
FT                   /protein_id="ACF49721.1"
FT                   /translation="MMHFATRNTLKSRLLLLPLLSLPMTLATAANTLETVQVTAKRPAG
FT                   GGGVGGFGFGGGSGVHLSESQMDNGGGGGAIPTETAKEQPTDDKEKDCNGRKGNPVVLY
FT                   SGNKVEPELDFASQGEMGLFLQRNYNHYWSATGLFGNHWLSNFDYSLAFTDANQLAWVQ
FT                   RPDGRRIKYLKDPASGRWYEDKAQPIAYLSANGDGTFTLRNENNGTETYNVEGYITRLS
FT                   NEQGVSWTFSYADRYLQKVTHSSGRSVSFGWANGQVSQVTDPAGNVYRYTYTPNVFGNG
FT                   RGRLASSTLPGTPATTISYHYEDARFPGALTGKSFDGVRYSTFAYDAERRAISTEHNGG
FT                   IERFRFSYAVRSTEPVLPPPAPTRPGGVRADEERGWCEQRTGGSRICYQPRSLPVDSLP
FT                   MESALGMTAAAAPGLTRPVDIDVTVINPLGRSTTYTFKDGKMVSTKGDPSPNCPASYKE
FT                   QSYDANGYPDLVHDFQDNLTNFDYSAQGYLLKRVEAVGSSAERTTLQEWDTTRNRLLKT
FT                   TVVGDLEVAYSYDDRGNVASATERNLTARGVPSQTRVTRSTYTYHANGLKASIKVDGPL
FT                   AQDDVTSVFNGQGDLTSVTNALGHTISYSNYNGLGLPGRIVNANGGVRELTYDGRGRVV
FT                   SDRTSSGTGWATTAIGYTAAGDIASLTQPDGVTVRYGYDAGRRLTQEVRSMGDGKWAWI
FT                   RHSYNNASNRTRTEVSQTDYPMDTVVKGMIDEITHDGQWNWFVRGWACSTGSAGSIQVD
FT                   GYADGNVYLGSTQANLASEPGVAAACQASGSAYRYQLPISLAQRQQLGGRKFSIYGQSP
FT                   QGRGQDRPLPNSGVLAIPTAKIVGDIGGVTQDGNWNFFLEGWACSIGVDSSIDVHVYAG
FT                   NSAWAGGTFVASGRANLATDGNVASACQARGNAYWFKIPLDGNLRSAHGGKALYVHGIS
FT                   PWGGDHLTINRSGTFTVPAVVRSAEFVSFNAYPTNITNGRQSTLTIQVRNTGNVVWDGN
FT                   TYLAWGQDQLDQSRALAGPVSPGGIASFSIDVAPYHDGIGIRSFAYIAQMATNGMAWGP
FT                   RPYTMIAVENADWYCPPNSTTCEAPM"
     atgatgcact ttgcaacacg gaacactctg aagtcccgtc ttcttcttct gccgctgctt        60
     tccctgccga tgacattggc aacggcggca aacactctcg aaaccgttca agtcaccgcc       120
     aaacgccctg ctggaggtgg cggtgtaggt ggttttggat ttggcggcgg cagtggtgtc       180
     cacctgtccg agtctcaaat ggacaatggc ggcggcggcg gtgcaattcc gaccgaaacc       240
     gcgaaggagc agccgaccga tgacaaagag aaggactgca atggtcgtaa gggcaatccc       300
     gtcgtgctct acagcggcaa caaggttgaa ccagaacttg atttcgccag tcagggcgaa       360
     atgggactgt tcctgcagcg caactacaat cactattgga gcgcgaccgg gctgttcggc       420
     aatcactggc tgagcaactt cgattattcg ctcgcattca ccgatgcaaa tcagctggcg       480
     tgggtgcaac ggcctgacgg tcgccgcatc aagtacctca aggatcctgc cagcggtcgc       540
     tggtatgagg acaaggccca gcccatcgcg tacctctccg cgaacggcga tggcacgttt       600
     acgcttcgaa acgaaaacaa cggtacggag acctacaacg tcgagggcta tatcacccga       660
     ctcagcaatg agcagggcgt gagctggacg ttctcctatg ctgaccgcta tctgcagaag       720
     gtgacccact cctcgggacg cagcgtcagc tttggttggg ccaatggaca ggtaagccag       780
     gtgaccgatc cagccggcaa cgtctatcgc tacacctata cccccaatgt tttcgggaac       840
     ggacgtggcc ggcttgccag ctcgacgctg ccaggcacac cagcgacgac gatcagctac       900
     cactacgaag atgctcgctt cccgggtgcc ctgactggca agtcctttga tggcgtgcgc       960
     tattccactt ttgcgtacga cgcggagcgg cgcgccatca gcacggagca caacggtggc      1020
     attgagcgat tccgcttcag ctatgccgtg cgcagcaccg aaccggtgct cccgccgccc      1080
     gcaccgactc gacccggcgg tgtccgcgcc gacgaagagc gtggatggtg cgaacagcgc      1140
     accggaggct cacgcatctg ctatcaaccg cgctcgctgc ctgttgactc gctgccgatg      1200
     gagagcgctc tcggtatgac ggccgccgct gcgccgggcc ttacgcggcc cgtcgatatt      1260
     gatgtcactg tgatcaaccc tcttggccgt agcaccactt acacgttcaa ggacggaaag      1320
     atggtatcga ccaagggtga tccgtcgccg aactgccctg ccagctacaa ggagcagagt      1380
     tatgacgcca atggataccc ggatctggtc catgacttcc aggacaatct gaccaacttc      1440
     gactacagcg ctcagggtta cctgctgaag cgggtggaag ctgtcggcag ctcggccgaa      1500
     cgtacaacgt tgcaggagtg ggataccacg cggaacagac tcctcaagac aacggtggtg      1560
     ggtgacctcg aggttgccta ctcctatgac gatcgcggaa acgtggccag cgcaaccgag      1620
     cgcaatctga cggcacgtgg cgtacccagc cagacacgag tgacccggag cacgtatacc      1680
     tatcacgcaa acggattgaa ggcctcgatc aaagtcgatg gaccgcttgc gcaggacgac      1740
     gtcacctccg tgttcaacgg ccaaggcgat ctgaccagcg tcaccaacgc actcggtcat      1800
     acgatcagct attccaacta caacggattg gggttgccgg gacgcatcgt caatgcgaat      1860
     ggtggtgtgc gagagctgac gtatgacggc cgcggccgcg ttgtatccga cagaaccagt      1920
     tcgggaaccg gctgggcgac taccgccatt ggctacaccg ctgcaggtga catcgcctcg      1980
     cttacccagc ctgatggcgt gacagtccgc tacggctacg atgcagggcg ccgcctgaca      2040
     caggaagtcc gttcgatggg agacggcaag tgggcgtgga tccgtcatag ctacaacaac      2100
     gcttccaatc gcacgcgcac tgaggtttca caaaccgact atccgatgga tacggtcgta      2160
     aaggggatga ttgatgaaat cacccacgac ggccagtgga actggttcgt tcgaggttgg      2220
     gcctgctcca ccggatcggc gggatccatc caggtggatg gttacgccga tggcaacgtc      2280
     tacctgggta gcactcaagc aaaccttgcc agcgagccag gagttgccgc ggcgtgccaa      2340
     gcatcaggga gtgcctatag gtatcagttg ccgatatcgc tagcccagag gcaacagttg      2400
     ggcggtcgca agttttccat ctacggccaa tctccgcagg ggcgcggcca ggaccgaccg      2460
     cttccgaact ctggggtgct cgcgattcca acggcaaaaa tcgttggtga tatcggcggc      2520
     gtgacccagg acggaaactg gaacttcttc ctggaaggct gggcctgctc gatcggcgtg      2580
     gactcatcga tcgatgtgca cgtctatgca ggaaactccg cttgggcagg gggcaccttt      2640
     gttgccagtg gtcgtgccaa cctcgcaacg gacggcaacg tcgccagcgc ttgccaagca      2700
     cgcggaaatg cgtattggtt caagattcca ctcgatggca atctgcgatc agcgcatggt      2760
     ggcaaggcgc tttatgttca tggcatctcg ccgtggggtg gtgatcatct gaccatcaat      2820
     cgctcgggca ctttcaccgt cccagccgtt gtgcggagtg cggagttcgt ttccttcaat      2880
     gcctatccca ccaacatcac caatggacgg caaagcacgt tgaccataca ggtccgcaac      2940
     acaggcaacg tcgtatggga tggaaacact taccttgcat ggggccagga ccagctggat      3000
     caatcccgag cactggccgg gccggtgtcc cctggaggga ttgcatcgtt cagcatcgac      3060
     gtcgcgccct accacgatgg catcgggatc aggagctttg catacattgc ccagatggcg      3120
     accaacggta tggcttgggg accccggccc tacaccatga tcgcggtaga aaacgcggat      3180
     tggtactgcc cgccaaacag caccacctgc gaggcgccga tgtga                      3225
//

If you have problems or comments...

PBIL Back to PBIL home page