(data stored in ACNUC7421 zone)

EMBL: CP001111.PE160

CP001111.PE160       Location/Qualifiers
FT   CDS_pept        complement(201909..202784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0160"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: cvi:CV_3289 probable
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49865"
FT                   /db_xref="GOA:B4SSI3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSI3"
FT                   /protein_id="ACF49865.1"
FT                   /translation="MSRLHLDLEVLRSFVTGVELGSFALAAQQLHLSTSAISAQLKRLQ
FT                   AQIGTPLLEKTGRGLTPTAQGEALLSYARRLLELNDEAIQAVRGAPLQGAIRVGLAEDF
FT                   GASLLPGILSRFAQAHPQLRIDARVCRTATLMEALARDTLDLALVWGDDHDWPYSQHLC
FT                   RLPLHWIGSADPAPAGGPVCLATLEAPCLMRQRACDALDHAGLEWRESFSSSSLAAIWA
FT                   AVAAGLGVTVRTAAGMPDHLRIRHDLPTLPAINLLLCWNQARPGTAVQQLAAIIENAVH
FT                   TSVPGMARSA"
     atgtcgcgat tacatctgga tctggaagtc ctgcgcagct tcgtgaccgg cgtggagctg        60
     ggcagcttcg ctctggccgc acagcagttg catctctcca cgtcggccat cagcgcccag       120
     ctcaagcgat tgcaggcgca gatcggcacg ccactgctgg agaaaaccgg ccgcggcctg       180
     acgcccaccg cgcagggcga agccctgctc agctatgcgc gtcgactgct ggaattgaac       240
     gacgaagcca tccaggccgt acgcggcgct ccgttgcagg gcgccatccg ggtcggactc       300
     gccgaggatt tcggagcatc gctgctgccc ggcatcctgt cgcgcttcgc acaggcgcac       360
     ccgcagctgc gcatcgatgc gagggtctgt cgcacggcga ccttgatgga ggcattggcc       420
     cgcgacacgc tggatctggc actggtctgg ggcgatgacc atgactggcc ctattcccag       480
     catctgtgcc gcctgccgct gcactggatc ggcagcgccg acccggcccc cgctggcggg       540
     ccggtgtgcc tggccacgct tgaagccccg tgcctgatgc gccaacgcgc ctgcgacgcc       600
     ctcgaccatg ccggtctgga atggcgggaa agcttctcga gcagcagcct ggcggcgatc       660
     tgggcagcgg tggctgccgg gcttggggtc acggtacgca ccgctgccgg aatgccggac       720
     cacctgcgga tccgccatga cctgccgaca ttgccggcga tcaatctgtt gctgtgctgg       780
     aaccaggcac gccccggcac cgccgtgcag cagctggccg cgatcatcga aaacgccgtg       840
     cacacctcgg tgccggggat ggctcgatcc gcctga                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page