(data stored in ACNUC7421 zone)

EMBL: CP001111.PE164

CP001111.PE164       Location/Qualifiers
FT   CDS_pept        complement(204205..204681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0164"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC0231 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49869"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSI7"
FT                   /protein_id="ACF49869.1"
FT                   /translation="MNAKTIAIAIALIAGTAVVSSVQASESIKTLSTVQVRPAADQLAQ
FT                   QAWEQASGIPTLATVEVRPSSDQLAERNGYVATPVAAAMPITTLASVEVRPSLEQRVAL
FT                   VAEQEAQRYAATLAAAATSVANQVITNLPAMQVRPSAADLQALATETAQVLLRP"
     atgaacgcca agaccattgc catcgccatc gccctgatcg ccggcaccgc ggttgtttcg        60
     tcggtgcagg cctccgaatc catcaagacc ctgtccaccg tgcaggttcg cccggccgcc       120
     gaccagctgg cccagcaggc ctgggaacag gccagcggca tcccgaccct ggccacggtg       180
     gaagttcgcc cgagcagcga ccagctggcc gagcgcaacg gctacgtcgc caccccggtt       240
     gctgccgcga tgccgatcac caccctggcc tcggtggaag ttcgcccgag cctggagcag       300
     cgtgtcgccc tggtcgccga gcaggaagcc cagcgctatg ccgccaccct ggctgctgct       360
     gccaccagcg tcgccaacca ggtcatcacc aacctgccgg caatgcaggt tcgcccgagc       420
     gccgccgacc tgcaggccct ggccaccgaa accgcccagg tcctgctgcg cccgtaa          477
//

If you have problems or comments...

PBIL Back to PBIL home page