(data stored in ACNUC7421 zone)

EMBL: CP001111.PE165

CP001111.PE165       Location/Qualifiers
FT   CDS_pept        205097..207946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0165"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   xcv:XCV0666 putative zinc metalloprotease precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49870"
FT                   /db_xref="GOA:B4SSI8"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSI8"
FT                   /protein_id="ACF49870.1"
FT                   /translation="MSLALRPRAALLAVALSTALGTLAPTSALAAKPAAPAKVDIPFEQ
FT                   FTLPNGLRVIVHTDRKAPIVAVNVWYHVGSKDEPAGRTGFAHLFEHLMFQSSENHDGEY
FT                   FEPFKQVGATGQNGTTNTDRTNYFENVPTTALDMALWMESDRMGHLVGAIDQAALDEQR
FT                   GVVQNEKRQGENQPYGQAWDQLNKALYPVGHPYHHGVIGSMNDLNAASLDDVKTWFRTW
FT                   YGPNNAVLVLAGDIDLATAKEKAARYFGSIPAGPSMAQPAVNVAKRSADTRETMTDKVP
FT                   QARIYRAWNVPQVGTTDIDQLQLFAEVLGGAKSSRLSQRLQHQDKLVDSIGSGLSASQL
FT                   GSNFVIVATVKQGQDPAKVEKIIDEELDRLIKQGPTAAELERAKTGARAGFIRGIERIG
FT                   GFGGKADALAECAVFTGDPGCFRTSLANIDKASAADLSRLGAQWLDKGSHTLVIAPGER
FT                   VALKEDPSQAPKPFNVPAVDPKYSTLPEQVDRKAGVPQTREFPQLKFPALQRATLKNGT
FT                   QVILAERHEIPVVQFSYQFPGGFSADQGRKPGTANFTMSLMTEGAGRLGSLAFADAADA
FT                   LGASLDASAGLDSMSVDLSALKENLAPSLALYRDLLREPRFEQGEIDRVKATWIAGIQQ
FT                   EKVNPGAVAMRVLPPLLYGKGHPYAIPFTGSGDEAAINGLTREDLVDFHQDWLRPQNGT
FT                   LIVVGDTTLAEIVPLLDKQLADWKATGEAPQVKAATDVALPKGPRVFLIDQPGAVQANL
FT                   FAGQVVPPSSAASSTRFDIANGVIGGDFTSRLNMNLREDKHWSYGARSSASNSVGQRPW
FT                   MASAPVQIDKTGPALAEMRKEIAAFADGSKPATAGEVNRIRNIQTLSLPGAYETASAVA
FT                   ASIGSIVQFKRPDDYVLRRKAEIEAMTPAQVQQAAAEIKPQALTWVVVGDLKQTEAAVR
FT                   ALNLGEVTVIDAEGNPVKK"
     atgtctctcg cccttcgccc gcgcgctgca ctgctggccg tcgccctcag caccgccctg        60
     ggcacgcttg cgcccacctc cgcgcttgcc gccaagccgg cggcaccggc caaggtcgat       120
     atcccgtttg agcagttcac cctgcccaat ggcctgcgcg tgatcgtgca taccgatcgc       180
     aaggcgccga tcgtcgcggt caacgtctgg taccacgtcg gcagcaagga cgagccggcc       240
     ggccgcaccg gcttcgcgca cctgttcgaa catttgatgt tccagagcag cgaaaaccac       300
     gacggcgagt acttcgagcc cttcaagcag gtgggtgcca ccggccagaa cggcaccacc       360
     aacaccgacc gcaccaacta cttcgagaac gtgccgacca ccgcgctgga catggcgctg       420
     tggatggagt cggaccgcat gggccacctg gtcggtgcga tcgaccaggc cgcgctggac       480
     gagcagcgtg gcgtggtgca gaacgagaag cgccagggcg agaaccagcc ctatggccag       540
     gcctgggatc agctcaacaa ggcgctgtac ccggtcggcc acccgtacca ccacggtgtg       600
     atcggttcga tgaacgatct caacgccgct tcgctggacg acgtgaagac ctggttccgc       660
     acctggtacg gcccgaacaa cgcggtgctg gtgctggccg gtgacatcga cctggccacc       720
     gccaaggaaa aggccgccag gtacttcggc agcatcccgg ccggcccgag catggcgcag       780
     ccggcggtga acgtggccaa gcgcagcgcc gatacccgcg agacgatgac cgacaaggtg       840
     ccgcaggcgc gcatctaccg tgcctggaac gtgccgcagg tcggcaccac cgacatcgat       900
     cagctgcagc tgttcgccga agtgctgggc ggtgccaagt cctcgcgcct gagccagcgc       960
     ctgcagcacc aggacaagct ggtggacagc atcggctcgg gcctgtcggc ctcgcagctg      1020
     ggctccaact tcgtgatcgt ggcgaccgtg aagcagggcc aggacccggc caaggtcgag      1080
     aagatcatcg acgaggaact ggatcgcctg atcaagcagg gcccgaccgc ggccgagctg      1140
     gagcgcgcca agaccggtgc ccgcgccggc ttcatccgtg gcatcgagcg cattggtggc      1200
     ttcggcggca aggccgatgc gctggccgag tgcgcggtgt tcaccggcga cccgggctgc      1260
     ttccgtacct cgctggccaa catcgacaaa gccagtgccg ccgacctcag ccgcctgggc      1320
     gcacagtggc tggacaaggg cagccacacc ctggtgatcg caccgggtga gcgcgtggcg      1380
     ctgaaggaag atcccagcca ggcaccgaag ccgttcaacg taccggcggt ggacccgaag      1440
     tacagcaccc tgcccgaaca ggtggaccgc aaggccggtg tgccgcagac ccgcgaattc      1500
     ccgcagctga agttcccggc gttgcagcgc gccacgctga agaatggcac ccaggtgatc      1560
     ctggccgaac gccatgagat tccggtggtg cagttcagct accagttccc gggcggcttc      1620
     agcgccgacc agggccgcaa gccgggtacc gccaacttca ccatgagcct gatgaccgaa      1680
     ggtgccggca ggctcggctc gctggccttc gccgatgctg ccgatgcgct gggcgccagc      1740
     ctggatgcct cggccggcct ggactcgatg agcgtggacc tgtcggcact gaaggaaaac      1800
     ctggcaccgt cgctggcgct gtaccgcgac ctgctgcgtg agccgcgctt cgagcagggc      1860
     gagatcgacc gggtcaaggc gacctggatc gccggcatcc agcaggagaa ggtcaacccg      1920
     ggtgcggtgg cgatgcgcgt gctgccgccg ctgctgtacg gcaagggcca cccgtatgcc      1980
     attccgttta ccggcagcgg tgacgaggcg gcgatcaatg gcctgacccg cgaagacctg      2040
     gtcgacttcc accaggattg gctgcgcccg cagaacggca ccctgatcgt ggtcggtgac      2100
     accaccctgg ccgagatcgt gccgctgctg gacaagcagc tggccgactg gaaggcgacc      2160
     ggcgaagcgc cgcaggtgaa ggcggccacg gatgtggcgc tgccgaaggg cccgcgcgtg      2220
     ttcctgatcg accagccggg tgcagtgcag gccaatctgt tcgccggcca agtggtgccg      2280
     ccgtccagcg ccgccagctc gacccgcttc gatatcgcca acggcgtgat cggtggcgac      2340
     ttcacctcgc gcctgaacat gaacctgcgc gaggacaagc actggtcata cggtgcgcgc      2400
     agcagtgcga gcaactcggt gggccagcgg ccgtggatgg ccagcgcacc ggtgcagatc      2460
     gacaagaccg gcccggcgct ggcggaaatg cgcaaggaaa tcgccgcgtt cgccgatggc      2520
     agcaagccgg ccaccgccgg cgaggtcaac cgcatccgca acatccagac cctgagcctg      2580
     cctggtgcct acgagaccgc cagcgcggtg gccgcaagca tcggctcgat cgtgcagttc      2640
     aagcgtccgg atgactacgt gctgcgtcgc aaggccgaga tcgaggcaat gactccggcg      2700
     caggtgcagc aggccgccgc cgagatcaag ccgcaggcac tgacctgggt ggtggtgggt      2760
     gacctcaagc agactgaagc ggcggtgcgt gcgctgaatc tgggtgaggt gacggtgatc      2820
     gacgccgaag gcaacccggt caagaaataa                                       2850
//

If you have problems or comments...

PBIL Back to PBIL home page