(data stored in ACNUC7421 zone)

EMBL: CP001111.PE167

CP001111.PE167       Location/Qualifiers
FT   CDS_pept        208572..209588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0167"
FT                   /product="3-Oxoacyl-(acyl-carrier-protein (ACP)) synthase
FT                   III domain protein"
FT                   /note="PFAM: 3-Oxoacyl-[acyl-carrier-protein (ACP)]
FT                   synthase III domain protein; KEGG: xcb:XC_0222
FT                   3-oxoacyl-(acyl carrier protein) synthase III"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49872"
FT                   /db_xref="GOA:B4SSJ0"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSJ0"
FT                   /protein_id="ACF49872.1"
FT                   /translation="MLFKNVSIAGLAHVDAPHTLTTKEINERLQPTLDRLGIRTDVLGD
FT                   IAGIHARRLWDNGVLASDAATMAGRKALEDAGINATQVGLLVNTSVSRDYLEPSTASIV
FT                   SGNLGVSDECMTFDVANACLAFINGMDIAARMIERGDIDYALVVDGETANLVYEKTLER
FT                   MTAPDVTADDFRNELAALTTGSGAAAMVMARSELVPDAPRYKGGVTRSATEWNQLCLGN
FT                   LDRMVTDTRLLLIEGIKLAQKTFTAAKIALGWAVEELDQFVIHQVSQPHTAAFIKNFGI
FT                   DPKKVMTIFGEHGNIGPASVPIVLSKLKQLGKLKKGDRIALLGIGSGLNCSMAEVVW"
     atgctcttca agaatgtctc gatcgccggc ctggcacacg ttgatgcgcc gcatacgctg        60
     acgaccaagg aaatcaacga gcggctgcag ccgacgctcg atcgccttgg tatccgcacc       120
     gacgtgctcg gcgatatcgc cggcatccat gcccgccgcc tgtgggacaa cggcgtgctg       180
     gcctccgacg ccgccaccat ggccggccgc aaggcgctgg aagacgcagg catcaatgcg       240
     acgcaggtcg gcctgctggt caacacctcg gtcagccgcg actacctgga gccgtccacc       300
     gcgtcgatcg tctccggcaa cctcggcgtc agcgacgagt gcatgacctt cgacgtcgcc       360
     aatgcctgcc tggccttcat caacggcatg gatatcgcgg cgcgcatgat cgagcgcggc       420
     gatatcgact acgcgctggt ggtggacggc gagaccgcca acctggtgta cgagaagacc       480
     ctggagcgga tgaccgcgcc ggacgtcacc gccgacgact tccgcaacga actggcggcg       540
     ctgaccaccg gttcgggtgc cgctgccatg gtcatggcgc gctcggagct ggtgccggac       600
     gccccgcgct acaagggcgg cgtgacccgc tcggccaccg agtggaacca gctgtgcctg       660
     ggcaacctgg accgcatggt caccgacacc cgcctgctgc tgatcgaagg catcaagctg       720
     gcgcagaaga ccttcactgc cgccaagatc gcactcggct gggccgtgga agagctggac       780
     cagttcgtga tccaccaggt cagccagccg cacaccgctg cgttcatcaa gaacttcggc       840
     atcgacccga agaaggtcat gaccatcttc ggcgagcacg gcaacatcgg cccggcctcg       900
     gtgccgatcg tgctgagcaa gctcaagcag ctgggcaagc tgaagaaggg cgatcgcatc       960
     gcgcttctgg gcatcggctc gggcctgaac tgctcgatgg ctgaagtggt ctggtaa         1017
//

If you have problems or comments...

PBIL Back to PBIL home page