(data stored in ACNUC7421 zone)

EMBL: CP001111.PE169

CP001111.PE169       Location/Qualifiers
FT   CDS_pept        complement(210711..211136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0169"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153; KEGG:
FT                   xac:XAC0236 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49874"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSJ2"
FT                   /protein_id="ACF49874.1"
FT                   /translation="MQHPCMTCGACCTQYRVAFHWMESDEVTPGGVPHQLTEVLDPHRL
FT                   CMRGTHSKPVRCVALDAQIGVYSRCTIHPNRPSVCREVDASWEYGKASPQCDKARIAYG
FT                   LDPLTLADWRWRDEAGNDDDHPDDNGNSPSPQAPIAA"
     atgcaacatc cctgcatgac ctgcggcgcc tgctgcactc aataccgcgt ggccttccac        60
     tggatggaat cggacgaggt cacgcccggc ggcgtccccc accagctgac cgaggtgctc       120
     gatccgcatc gcctgtgcat gcgcggcacc cactccaagc cggtgcgctg cgtggcgctg       180
     gatgcgcaga tcggcgtgta ttcacgctgc accatccacc ccaaccggcc cagcgtgtgc       240
     cgcgaagtgg atgcatcgtg ggagtacggc aaggccagcc cgcagtgcga caaggcgcgc       300
     atcgcctatg gcctggatcc gttgaccctg gccgactggc gctggcgcga cgaagcgggc       360
     aacgacgacg accacccgga cgacaacggc aacagcccgt caccgcaggc gccgatcgcg       420
     gcgtag                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page