(data stored in ACNUC7421 zone)

EMBL: CP001111.PE171

CP001111.PE171       Location/Qualifiers
FT   CDS_pept        212896..213888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0171"
FT                   /product="3-beta hydroxysteroid dehydrogenase/isomerase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; dTDP-4-dehydrorhamnose
FT                   reductase; NmrA family protein; Male sterility domain;
FT                   KEGG: xcb:XC_0229 NAD(P)H steroid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49876"
FT                   /db_xref="GOA:B4SSJ4"
FT                   /db_xref="InterPro:IPR002225"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSJ4"
FT                   /protein_id="ACF49876.1"
FT                   /translation="MKILVTGGGGFLGQALCRGLVERGHQVLAFNRSHYPELQAMGVGQ
FT                   IRGDLADAQAVLHAVAGVDAVFHNGAKAGAWGSYDSYHQANVVGTDNVIAACRAHDISR
FT                   LVYTSTPSVTHRATHPVEGLGADDVPYGEDFQAPYAATKAIAEQRVLAANDATLATVAL
FT                   RPRLIWGPGDQQLVPRLAERARQGRLRLVGDGNNKVDTTYIDNAALAHFLALDALAPGA
FT                   ACAGRAYFISNGEPLPMRELVNKLLAAVGAPTVDKAISFKTAYRIGAVCERLWPLLRLR
FT                   GEPPLTRFLAEQLCTPHWYSMEPARRDFGYVPQVSIEEGLRRLKASSAA"
     atgaagatcc tggtcaccgg tggtggtggt ttccttggcc aggcgctgtg ccgcggtctg        60
     gtcgaacgtg gccaccaggt gctggcgttc aaccgcagcc actacccgga actgcaggcc       120
     atgggcgtgg gccagatccg cggcgatctg gccgatgcgc aggcggtgct gcacgcggtg       180
     gccggcgtcg atgcggtatt ccacaacggt gcgaaggccg gcgcctgggg cagctatgac       240
     agctaccacc aggccaacgt ggtcggcacc gacaacgtca tcgcggcctg tcgtgcacat       300
     gacatcagcc gcttggtcta cacctccacg cccagcgtga cccaccgcgc cacccatccg       360
     gtggaaggcc ttggtgccga cgacgtgcca tacggcgagg acttccaggc gccgtatgcg       420
     gcgaccaagg cgatcgccga acagcgcgtg ctggccgcca acgatgcaac gctggccacg       480
     gtggcgctgc gcccgcgcct gatctggggc ccgggcgacc agcagctggt gccccgcctg       540
     gccgaacgcg cacggcaggg gcgcctgcgc ctggtcggcg atggcaacaa caaggtcgat       600
     accacctaca tcgacaacgc cgcgctcgcg catttcctcg ccttggatgc actggcaccg       660
     ggtgcggcct gtgcgggcag ggcgtacttc atttccaacg gcgagccgct gccgatgcgc       720
     gagctggtca acaagctgct ggccgctgtg ggtgcgccga cggtggacaa ggcgatcagc       780
     ttcaagaccg cttatcgcat tggtgcggtc tgcgaacggc tgtggccgct gctgcgcctg       840
     cgcggcgagc cgccgttgac ccgcttcctg gccgagcagc tgtgcacgcc gcactggtac       900
     agcatggagc cggcacgccg ggacttcggt tacgtgccgc aggtcagcat tgaagaaggg       960
     ctgcgcaggc tgaaggcttc atctgccgca tag                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page