(data stored in ACNUC7421 zone)

EMBL: CP001111.PE173

CP001111.PE173       Location/Qualifiers
FT   CDS_pept        complement(214313..215407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0173"
FT                   /product="D-alanine/D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /note="KEGG: xom:XOO_0324 D-alanyl-alanine synthetase A;
FT                   TIGRFAM: D-alanine/D-alanine ligase; PFAM: ATP-dependent
FT                   carboxylate-amine ligase domain protein ATP-grasp;
FT                   D-alanine--D-alanine ligase domain protein; RimK domain
FT                   protein ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49878"
FT                   /db_xref="GOA:B4SSJ6"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSJ6"
FT                   /protein_id="ACF49878.1"
FT                   /translation="MARTRVGIIFGGKSSEHEVSLQSAKNILDALNRERFEPVLVGIDK
FT                   QGQWHLSQPDTFLINADDPSRIALHRSGTSLAVRPGAEQSQLQPSDAASALGQIDVVLP
FT                   IVHGPLGEDGALQGLLRMANLPFVGSPVLGSAVAMDKDVTKRLLRDAGLKVAPWLCIRR
FT                   HQAAAVDVDAVIAQLGLPLFVKPANQGSSVGVSKVKDAAGFAGALELALRYDHKVLVES
FT                   AVVGREIECAVLGNTLPQASLCGEVVVHDEFYAYDTKYINEDGAEVVVPADIDADTQAR
FT                   IQQIALQAYQALECAGMARVDVFLTADGEIVINEVNTLPGFTRISMYPKLWGASGVDYT
FT                   TLITRLIELALERHAADRGLHSAV"
     atggcacgga cccgggtcgg catcatcttc ggtggcaagt cttccgagca cgaagtttca        60
     ctgcagtcgg cgaagaacat cctcgatgcg cttaatcgcg agcgcttcga gccggtgctg       120
     gtcggcatcg acaagcaggg ccagtggcat ctgagccagc cggatacctt cctgatcaat       180
     gccgatgatc cgtcgcgcat cgcgctgcat cggtccggca cgtcgctggc ggtacgcccg       240
     ggtgccgagc agtcacaact gcagccgtcc gatgcagcca gtgcgctggg acagatcgat       300
     gtggtgctgc cgatcgtgca tgggccgctg ggcgaggacg gtgcgttgca gggcctgctg       360
     cgcatggcca acctgccctt cgtcggttcg ccggtgctgg gctcggcggt ggcgatggac       420
     aaggacgtga ccaagcgtct gctgcgcgac gccgggctga aggttgcacc gtggctgtgc       480
     atccgtcgcc atcaggcggc ggcagtcgat gtcgatgcgg tgattgcgca gctcggcctg       540
     ccgttgttcg tgaagccggc caaccagggt tcgtcggtgg gcgtgagcaa ggtgaaggac       600
     gcggcgggtt tcgccggggc actggaactg gcgctgcgct acgaccacaa ggtgctggtc       660
     gaatcggcgg tggtcggtcg cgagatcgag tgcgcggtgc tgggcaacac gcttccgcag       720
     gccagcctgt gcggcgaggt ggtggtgcac gacgagttct acgcctacga caccaagtac       780
     atcaacgagg atggcgccga ggtggtggtg ccagcggata tcgatgccga tacgcaggcg       840
     cgtatccagc agatcgcgct gcaggcctac caggcgctgg agtgcgcagg catggcgcgc       900
     gtggatgtgt tcctcaccgc agacggtgag atcgtcatca acgaggtcaa cacgctgccg       960
     ggcttcaccc gcatcagcat gtacccgaag ctgtggggcg ccagcggtgt ggattacacg      1020
     acgttgatta cccgcctgat cgaactggcg ctggagcgcc atgcagccga tcgcggattg      1080
     cacagcgctg tgtag                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page