(data stored in ACNUC7421 zone)

EMBL: CP001111.PE178

CP001111.PE178       Location/Qualifiers
FT   CDS_pept        complement(219783..220310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0178"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xom:XOO_0319 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49883"
FT                   /db_xref="InterPro:IPR018637"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSK1"
FT                   /protein_id="ACF49883.1"
FT                   /translation="MTRTAPALPSLLRRLALLLALAVASTPALAAPPTDGDINRLLSAS
FT                   RAQSMIDTMLPQIEAMQQQQFQQVAAQRQLNAQQQEQLKRIQARTSQTLRQALSWQQLR
FT                   PMYVDLYKKTFSKEDVLAMAEFYESAAGQSLLDKTPALMQNVMVAIQARMQPLFADLQK
FT                   DLEAIVNEPEKK"
     atgacccgca ccgcacccgc cctgccgtcc ctgctgcgcc gcctggcgct gctgctggca        60
     ctggccgtgg ccagcacccc cgcgctggcc gccccgccga ccgatggcga catcaaccgc       120
     ctgctgtcag cctcgcgcgc gcagagcatg atcgacacca tgctgccgca gatcgaggcg       180
     atgcagcagc agcagttcca gcaggtggcc gcgcagcgcc agctcaacgc ccagcagcag       240
     gagcagctga agcggatcca ggcgcggacc agccagaccc tgcgccaggc cctgtcgtgg       300
     cagcagctgc gcccgatgta cgtggacctg tacaagaaga cgttcagcaa ggaagacgtg       360
     ctggcgatgg ccgagttcta cgagagcgcc gccggccaga gcctgctgga caagaccccg       420
     gcgctgatgc agaacgtgat ggtggcgatc caggcccgca tgcagccgct gttcgcggac       480
     ctgcagaagg acctggaagc gatcgtcaac gagccggaaa agaaatga                    528
//

If you have problems or comments...

PBIL Back to PBIL home page