(data stored in ACNUC7421 zone)

EMBL: CP001111.PE179

CP001111.PE179       Location/Qualifiers
FT   CDS_pept        220445..220876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0179"
FT                   /product="Class I peptide chain release factor"
FT                   /note="PFAM: Class I peptide chain release factor; KEGG:
FT                   xcb:XC_0237 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49884"
FT                   /db_xref="GOA:B4SSK2"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSK2"
FT                   /protein_id="ACF49884.1"
FT                   /translation="MGSGPVTISAQLEIPDGEIVERFVRASGAGGQNVNKVSTAVELRF
FT                   DVAGSPSLPEPLRERLLARRDRRMTGEGVLVIDAQRFRTQDRNREDARDRLAAFIQAGL
FT                   HVPKPRKATKPTLGSKLRRLDAKRGRAQVKRGRSSRDWE"
     atgggcagtg gaccggtcac catcagcgcg cagcttgaaa tccccgacgg cgagatcgtc        60
     gagcggttcg tgcgtgccag tggtgccggt ggccagaacg tcaacaaggt ctccaccgcg       120
     gtggaactgc gtttcgatgt ggccggctcg ccctcgttgc ccgaaccgtt gcgcgaacgc       180
     ctgctggcgc ggcgcgaccg gcgcatgacc ggcgaaggcg tgctggtcat cgacgcgcaa       240
     cgattccgta cccaggatcg caatcgcgag gatgcgcgcg atcggctggc ggccttcatc       300
     caggccgggc tgcacgtgcc caagccacgc aaggccacca agccgaccct cgggtcgaaa       360
     ctgcgtcgtc tggacgccaa acgcgggcgc gcgcaggtca agcgcgggcg ctcatcacgt       420
     gactgggagt ga                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page