(data stored in ACNUC7421 zone)

EMBL: CP001111.PE18

CP001111.PE18        Location/Qualifiers
FT   CDS_pept        22991..23173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49723"
FT                   /db_xref="GOA:B4SR22"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR22"
FT                   /protein_id="ACF49723.1"
FT                   /translation="MKIIYWLGIAFLWMLPLNVLLLTAGKLMSGGTLGEEELVGFGVAV
FT                   FGAAAGTILYRRRPR"
     atgaagatta tctactggct tggcatcgcg ttcctgtgga tgcttccatt gaacgtcctg        60
     ttgctgacgg ccggcaagct gatgtcgggt ggcacgcttg gagaagaaga gctcgttggc       120
     ttcggtgtgg cagtgttcgg tgcagcggcg ggcacgatcc tctatcgccg tcgcccacgg       180
     tag                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page