(data stored in ACNUC7421 zone)

EMBL: CP001111.PE19

CP001111.PE19        Location/Qualifiers
FT   CDS_pept        complement(23234..23941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0019"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC0018 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49724"
FT                   /db_xref="GOA:B4SR23"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR23"
FT                   /protein_id="ACF49724.1"
FT                   /translation="MHEQGPVDFIEVIHNAVPSEVCAAIVERLRATRGLQPGAVGSGVF
FT                   PELKHSKDLRISGLGGWQDVDQQLQIAVFNGLLTYLRRYPQALIAPLMLQIQDSNGQPR
FT                   RLSAEDFPDMPQQQLADLARTCLRPGAINLQWYAAGEGGYPYWHCELYPKDAQAETLHR
FT                   HVLWTLYLNDDFEEGETEFLFQGRKIAPRTGSLLIAPTAFTHTHRGNRPQGGDKFIATS
FT                   WILFQSAQKLFGG"
     atgcacgagc agggcccggt cgatttcatc gaagtcatcc acaacgccgt ccccagcgag        60
     gtctgcgcgg ccatcgttga gcgcctgcgc gctacgcgtg gcctgcagcc cggtgcggtg       120
     ggcagtggtg tgttcccgga actcaagcac agcaaggatc tgcgcatcag tggcctgggc       180
     ggctggcagg atgtcgatca gcagctgcag atcgcggtgt tcaatggcct gctgacttat       240
     ctacgccgtt atccacaggc gttgattgcg ccgctgatgt tgcagatcca ggacagcaac       300
     ggccaaccgc gacgcctgtc tgccgaggac ttccccgaca tgccgcagca gcagctggcc       360
     gatctggccc gcacctgcct gcgcccgggc gcgatcaacc tgcagtggta tgcggcgggc       420
     gagggcggct acccgtactg gcactgcgag ctgtacccga aggatgcgca ggccgagacc       480
     ctgcaccggc atgtgctgtg gacgctgtac ctcaacgacg acttcgaaga gggcgaaacc       540
     gagttcctgt tccaggggcg gaagatcgca cctcgtaccg gcagcttgct gatcgcgccg       600
     actgcgttca cccacaccca tcgtggcaac aggccgcaag gtggagacaa gttcatcgcg       660
     accagctgga ttctgttcca gagtgcgcag aagttgtttg gggggtga                    708
//

If you have problems or comments...

PBIL Back to PBIL home page