(data stored in ACNUC7421 zone)

EMBL: CP001111.PE195

CP001111.PE195       Location/Qualifiers
FT   CDS_pept        complement(238413..238727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0195"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_0251 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49900"
FT                   /db_xref="InterPro:IPR030976"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSL8"
FT                   /protein_id="ACF49900.1"
FT                   /translation="MSAKSPMTTVNAGRLLDLLCSDDAFRAEFTADAGAAMARHGLQAH
FT                   SGTSPCAIHNVLASKEEFQQVRQQIAALLAQRAAFNVPFMFESGHLQGSVHHSAVPQAA
FT                   "
     atgtccgcaa agtccccgat gaccactgtc aatgccggtc ggctgctcga cctgctgtgt        60
     tctgacgacg ccttccgcgc agagttcaca gccgatgccg gcgctgcgat ggcgcggcat       120
     gggctgcagg cacactccgg cacaagcccc tgcgccatcc acaacgtcct ggccagcaag       180
     gaagagttcc aacaggtgcg ccagcagatc gccgcgctcc tggcccagcg cgccgcattc       240
     aatgtcccct tcatgttcga atccgggcat ctgcagggaa gcgtgcacca ctccgccgta       300
     ccgcaggccg cttga                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page