(data stored in ACNUC7421 zone)

EMBL: CP001111.PE196

CP001111.PE196       Location/Qualifiers
FT   CDS_pept        complement(239128..241110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0196"
FT                   /product="Carbamoyl-phosphate synthase L chain ATP-binding"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; phosphoribosylglycinamide synthetase;
FT                   ATP-dependent carboxylate-amine ligase domain protein
FT                   ATP-grasp; Carbamoyl-phosphate synthase L chain
FT                   ATP-binding; Carbamoyl-phosphate synthetase large chain
FT                   domain protein; biotin carboxylase domain protein; KEGG:
FT                   xcv:XCV0271 biotin carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49901"
FT                   /db_xref="GOA:B4SSL9"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSL9"
FT                   /protein_id="ACF49901.1"
FT                   /translation="MFTKVLIANRGEIACRVIATCRRLGIATVAVYSDADRNARHVRLA
FT                   DEAIHIGPAAARESYLRGDVLLDAARRSGAQAIHPGYGFLSENADFADACAAAGITFIG
FT                   PPASAIRAMGDKSAAKALMAKAGVPLTPGYHGDQQAPDFLRAQADGIGYPVLIKASAGG
FT                   GGKGMRKVERSEDFVDALASCQREAASAFGNDHVLVEKYVERPRHIEIQVFGDSHGEAV
FT                   YLFERDCSVQRRHQKVLEEAPAPGMSAERRAAMGKAAVDAARAVGYVGAGTVEFIAGPD
FT                   GDFYFMEMNTRLQVEHPVTEYITGTDLVEWQLRVASGQPLPLRQEQLAIHGHAIEARLY
FT                   AEDADRGFLPSTGTLRRLRLPMPSANVRVDTGVEEGDSISPYYDPMIAKLIVWDVDRDA
FT                   ALRRMSQALADCQVVGVTTNAGFLRRLVNTDSFAHAKLDTALIEREQAALSAAGDSDDA
FT                   LWQLAAVAAVASTADAGIDARDPHSPWQAQDGWRLGASTPRALPLQQGERTHTLKVWVQ
FT                   ADGWRVQSDDAAPVQVIGTANAQGLTVQLGERRWSLQLLREGDQLYLFGADGQHRFTLH
FT                   DPVGESDTAVADAGSLLAPMPGKIVATLVAAGTEVKRGTPLVVLEAMKMEHTLQAPADG
FT                   TVKGYRAKAGDQVGDGAVLVDFEAA"
     atgttcacca aagtcctgat cgccaaccgc ggcgaaatcg cctgccgcgt catcgctacc        60
     tgccgacgtc tgggcatcgc taccgtggcg gtgtattccg atgccgaccg caacgcgcgc       120
     catgtgcgcc tggccgatga agccatccac atcggcccgg ccgccgcgcg cgaaagctac       180
     ctgcgcggcg acgtgctgct ggacgccgcg cgccgcagcg gtgcgcaggc gatccatccc       240
     ggctacggct tcctgtctga gaacgccgac ttcgccgatg cctgcgccgc cgccggcatc       300
     accttcatcg gcccgccggc cagtgcgatc cgtgcgatgg gtgacaagag cgcggccaag       360
     gcactgatgg ccaaggccgg tgtaccgctg accccgggct accacggtga ccagcaggca       420
     ccggacttcc tgcgcgcgca ggccgacggc atcggctacc cggtgctgat caaggccagc       480
     gccggtggcg gtggcaaggg catgcgcaag gtcgagcgca gcgaggactt cgtcgatgca       540
     ctggccagct gccagcgcga ggccgcctcg gcgttcggca acgaccacgt gctggtggaa       600
     aagtacgtgg agcgcccgcg ccatatcgag atccaggtgt tcggcgacag ccacggtgag       660
     gcggtctacc tgttcgagcg cgactgctcg gtgcagcgcc gccaccagaa ggtgctggaa       720
     gaagcaccgg cgccgggcat gagcgccgaa cgtcgcgccg cgatgggcaa ggccgcggtc       780
     gatgccgcgc gcgcggtggg gtacgtcggc gcgggcacgg tggagttcat tgccggcccg       840
     gacggcgatt tctatttcat ggaaatgaac acccgcctgc aggtcgagca cccggtcacc       900
     gaatacatca ccggcaccga tctggtcgag tggcagctgc gcgtggcctc gggccagccg       960
     ctgccgcttc gccaggaaca gctggccatc catggccatg cgatcgaggc gcggctgtac      1020
     gccgaggacg ccgaccgtgg cttcctgccc tccaccggca ccctgcgccg cctgcgcctg      1080
     ccgatgccat cggcgaatgt gcgcgtggat accggcgtgg aggaaggcga cagcatcagc      1140
     ccgtactacg atcccatgat tgccaagctg atcgtctggg acgtggaccg cgacgctgcg      1200
     ctgcgccgca tgagccaggc cctggccgac tgccaggtgg tgggcgtgac caccaatgcc      1260
     ggcttcctgc gccggctggt gaacaccgat tcgtttgcgc acgcgaagct ggatactgcg      1320
     ctgatcgagc gcgaacaggc ggcattgagc gcggcaggcg acagcgacga cgcactgtgg      1380
     cagctggcgg cggtggctgc tgttgccagc accgcagacg ccggcatcga cgcgcgcgac      1440
     ccgcattcgc cgtggcaggc gcaggatggc tggcgccttg gtgcctccac accgcgcgcg      1500
     ctgccgttgc agcagggcga acgcacgcac acgctgaagg tgtgggtgca ggccgatggc      1560
     tggcgtgtgc aaagcgatga cgcagcgccg gtgcaggtaa tcggtacggc caatgcgcag      1620
     ggcctgacgg tacagctggg cgagcgtcgc tggtcgttgc agctgctgcg cgagggcgac      1680
     cagctgtacc tgttcggcgc cgatggccag caccgcttca ccctgcatga tccggtgggc      1740
     gaatcggaca ctgccgtggc cgacgctggc agcctgctgg caccgatgcc gggcaagatc      1800
     gtcgcgacac tggtcgcggc cggtaccgag gtcaagcgcg gcacgccgct ggtggtgctg      1860
     gaagcgatga agatggagca caccctgcag gcaccggcag acggcacggt gaagggttac      1920
     cgcgccaagg ccggcgacca ggtgggtgac ggtgcggtgc tggtggactt cgaagcggcg      1980
     tga                                                                    1983
//

If you have problems or comments...

PBIL Back to PBIL home page