(data stored in ACNUC7421 zone)

EMBL: CP001111.PE2

CP001111.PE2         Location/Qualifiers
FT   CDS_pept        1823..2923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: xac:XAC0002 DNA polymerase III subunit beta;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49707"
FT                   /db_xref="GOA:B4SU12"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B4SU12"
FT                   /protein_id="ACF49707.1"
FT                   /translation="MRFTLQREAFLKPLAQVVNVVERRQTLPVLANFLVQVQNGQLSLT
FT                   GTDLEVEMVSRIAVEDAQDGETTIPARKLFEIIRALPDGSRITVSQTGDKITVQAGRSR
FT                   FTLATLPSNDFPSVDEVEATERVAIGEATLKELIERTAFAMAQQDVRYYLNGLLFDLRG
FT                   DALRTVATDGHRLALCETDLAKPSGSKRQIIVPRKGVTELQRLLESGDREIELEVGRSH
FT                   VRVKRDDVTFTSKLIDGRFPDYEAVIPIGADREVKVNRESLRASLQRAAILSNEKYRGI
FT                   RVEVSPGNLKISAHNPEQEEAQEEIEADTTVSDLAIGFNVNYLLDALSALRDEEVIIQL
FT                   RDSNSSALVRESSSEKSRHVVMPLRL"
     atgcgtttca cactgcagcg cgaagccttt ctcaagccgt tggcacaggt cgtcaacgtg        60
     gtcgaacgcc gccagaccct tccggttctg gccaatttcc tggtccaggt gcagaacggc       120
     cagctgtcgc tgaccggtac cgatctggaa gtggaaatgg tgtcgcggat cgcggttgaa       180
     gatgcgcagg acggcgaaac cacgatcccc gcccgcaagc tgtttgagat catccgcgcc       240
     ctgcccgatg gcagccggat caccgtctcg cagaccggtg acaagatcac cgtgcaggca       300
     ggccgcagcc gcttcaccct ggcaaccctg ccctccaacg acttcccgtc ggtggatgaa       360
     gtggaagcca ccgagcgcgt tgcgatcggc gaagcgaccc tgaaggagct gatcgaacgc       420
     accgcgttcg cgatggccca gcaggacgtg cgctactacc tcaacggcct gctgttcgac       480
     ctgcgtggtg atgcgctgcg tacggtcgcc actgacggtc atcgtctggc cctgtgcgaa       540
     accgatctgg ccaagcccag cggttccaag cgccagatca tcgtgccgcg caagggcgtg       600
     accgagttgc agcgcctgtt ggaaagcggc gaccgcgaga tcgagctgga agtcggccgt       660
     agccacgtgc gcgtcaagcg cgacgatgtc accttcacct cgaagttgat cgatggccgc       720
     ttcccggact acgaagcagt gatcccgatc ggcgccgatc gcgaggtcaa ggtgaaccgt       780
     gagtcgctgc gtgcgtcgtt gcagcgtgcg gcgatcctgt ccaacgagaa gtaccgcggt       840
     atccgcgtgg aagtctcgcc gggcaacctc aagatcagtg cgcacaaccc ggagcaggaa       900
     gaggcccagg aagagatcga ggcggacacc accgtcagcg acctggccat cggcttcaac       960
     gtgaactacc tgctggatgc cctgtccgcc ctgcgcgacg aggaagtcat catccagctg      1020
     cgcgattcca actcctcggc gctggtgcgt gaatccagca gcgagaagtc gcgccacgtg      1080
     gtgatgccgc tgcgtctctg a                                                1101
//

If you have problems or comments...

PBIL Back to PBIL home page