(data stored in ACNUC7421 zone)

EMBL: CP001111.PE206

CP001111.PE206       Location/Qualifiers
FT   CDS_pept        251258..253669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0206"
FT                   /product="ribonucleoside-diphosphate reductase, alpha
FT                   subunit"
FT                   /EC_number="1.17.4.1"
FT                   /note="KEGG: mxa:MXAN_5057 ribonucleoside-diphosphate
FT                   reductase, alpha subunit; TIGRFAM:
FT                   ribonucleoside-diphosphate reductase, alpha subunit; PFAM:
FT                   ribonucleotide reductase large subunit; ATP-cone domain
FT                   protein; Ribonucleotide reductase large subunit domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49911"
FT                   /db_xref="GOA:B4SSM9"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSM9"
FT                   /protein_id="ACF49911.1"
FT                   /translation="MTTESSATIEKESEFLLTSPPTANAMSVTKRNGTTELVDLNKIVR
FT                   AVQRSSEGLHAVDPMRVATRTISGLYNGATTRELDELSIRTAALLIGEEPEYGRLAARL
FT                   LANYIAKEVSGQEIYAFSQSVGRGHEVGLINDRLLNFVQTNARKLNDAIDMSLDLNFDY
FT                   FGLRTLYDRYLLRHPHTRKVIETPQQFFLRIASALSEDVPEALALYKRMGNLDYLPSSP
FT                   TLFNSGTTHEQLSSCFLLDSPQDSLESIYSKYGDIAQLSKFSGGIGVSYTRVRSRGSLI
FT                   KSTNGHSNGIVPWLKTMDSSVAAVNQGGKRKGAACVYLETWHADVEDFLELRDNTGDES
FT                   RRAHNLNLANWIPDLFMKRVEADQEWSLFDPRVVPEFTDLFGEAFEAAYLQAEAQGKAN
FT                   RTISARKLYSRMMRTLAETGNGWMTFKDKCNRASNQTLRAGNVIHLSNLCTEILEVTSA
FT                   EETAVCNLGSINLGNHFDGNGEFDFDKLADTVRLAVRQLDRVIDLNFYPIESARRGNLR
FT                   WRPVGLGCMGLQDVFFRKRLPFDGAEARALSKKIAETIYFHALETSVELAQERGKHPSF
FT                   ADTRAASGELQFDAWNVVPEDAERWDSLRERIKEHGLRNSLMIAIAPTATIASIAGCYE
FT                   CVEPQVSNLFKRETLSGDFLQVNRYLVNELKKLGHWTPEMRDAIKLAEGSIQGITQIPE
FT                   TLRHVYRTAWELPMRSLIDMAADRGAFIDQSASLNLFMESPNIGAMSSMYMYAWKQGIK
FT                   TTYYLRSRPATKIAKTTVSHAAGAAPEKVFSPEEAIACSLENPEACEACQ"
     gtgaccaccg aatccagcgc caccatcgag aaggaaagcg aattcctgtt gacgtcgccg        60
     ccgacggcca acgcgatgag tgtgaccaag cgcaatggca cgaccgagct ggtggatctg       120
     aacaagatcg tgcgcgcggt gcagcgttcc tccgaaggcc tgcacgccgt cgatccgatg       180
     cgcgtggcaa cccgcaccat ttccggcctg tacaacggcg ccaccacccg cgagctggac       240
     gaactgtcca tccgcaccgc cgccctgctg atcggtgaag agcccgagta cggccgcctg       300
     gccgcacgcc tgctggccaa ctacatcgcc aaggaagtct cgggccagga aatctacgcc       360
     ttctcgcagt cggttggtcg tggccacgaa gtgggcctga tcaacgaccg cctgctgaac       420
     ttcgtgcaga ccaacgcacg caagctcaac gatgcgatcg acatgtcgct ggacctgaac       480
     ttcgattact tcggcctgcg caccctgtac gaccgctacc tgctgcgcca tccgcacacc       540
     cgcaaggtga tcgagacccc gcagcagttc ttcctgcgta tcgccagcgc gctgagcgag       600
     gacgtgccgg aggccctggc gctgtacaag cgcatgggca acctggacta cctgccgtcc       660
     agcccgaccc tgttcaactc cggcaccacc cacgagcagc tgtcctcgtg cttcctgctg       720
     gattcgccgc aggattcgct ggagtcgatc tactccaagt acggcgatat cgcccagctg       780
     tcgaagttct ccggcggcat cggcgtcagc tacacccgcg tgcgttcgcg cggttcgctg       840
     atcaagtcca ccaacggcca ttccaacggc atcgtgccgt ggctgaagac catggattcg       900
     tcggtggctg cagtgaacca gggcggcaag cgcaagggcg cggcctgcgt gtacctggaa       960
     acctggcacg ccgacgtcga ggacttcctt gaactgcgtg acaacaccgg cgacgaatcg      1020
     cgccgtgcgc acaacctgaa cctggccaac tggatcccgg acctgttcat gaagcgcgtc      1080
     gaggccgacc aggaatggtc gctgttcgat ccgcgcgtgg tgccggagtt caccgacctg      1140
     ttcggtgaag ccttcgaagc cgcctacctg caggccgagg cacagggcaa ggccaaccgc      1200
     accatctccg cgcgcaagct gtactcgcgg atgatgcgca ccctggccga gaccggcaac      1260
     ggctggatga ccttcaagga caagtgcaac cgcgccagca accagaccct gcgcgccggc      1320
     aacgtgatcc acctgtccaa cctgtgcacc gaaatcctgg aagtcacctc ggccgaagag      1380
     accgcggtgt gcaacctggg ttcgatcaac ctgggcaacc acttcgacgg caacggcgag      1440
     ttcgatttcg acaagctggc cgacaccgtg cgtctggccg tgcgccagct cgaccgcgtg      1500
     atcgacctga acttctaccc gatcgaatcg gcgcgccgtg gcaatctgcg ctggcgcccg      1560
     gtcggcctgg gctgcatggg cctgcaggac gtgttcttcc gcaagcgcct gccgttcgac      1620
     ggcgccgaag cccgcgcgct gtcgaagaag atcgctgaga ccatctactt ccacgcgctg      1680
     gaaacctcgg tcgaactggc ccaggaacgc ggcaagcacc cgtccttcgc cgacacccgt      1740
     gcggccagcg gcgagctgca gttcgatgcc tggaacgtgg tgcccgaaga cgccgagcgt      1800
     tgggatagcc tgcgcgagcg catcaaggaa catggcctgc gcaactcgct gatgatcgcc      1860
     atcgcaccga ccgcgaccat cgcctcgatt gccggctgct acgagtgcgt tgagccgcag      1920
     gtgtccaacc tgttcaagcg cgaaaccctg tccggtgact tcctgcaggt caaccgctac      1980
     ctggtgaacg agctgaagaa gctgggccac tggaccccgg aaatgcgcga cgcgatcaag      2040
     ctggccgaag gctcgatcca gggcatcacg cagattccgg aaacgctgcg ccacgtctac      2100
     cgcaccgcgt gggaactgcc gatgcgttcg ctgatcgaca tggccgccga ccgtggcgcc      2160
     ttcatcgacc agtccgcctc gctcaacctg ttcatggaaa gcccgaacat cggcgcgatg      2220
     tcctccatgt acatgtacgc ctggaagcag ggcatcaaga ccacctacta cctgcgttcg      2280
     cgtccggcca ccaagatcgc caagaccacg gtcagccacg ccgcaggcgc ggccccggag      2340
     aaggtgttca gcccggaaga ggccatcgcc tgctcgctgg agaacccgga agcctgcgag      2400
     gcttgccagt aa                                                          2412
//

If you have problems or comments...

PBIL Back to PBIL home page