(data stored in ACNUC7421 zone)

EMBL: CP001111.PE209

CP001111.PE209       Location/Qualifiers
FT   CDS_pept        255764..256165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0209"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   xcb:XC_4072 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49914"
FT                   /db_xref="GOA:B4SSN2"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSN2"
FT                   /protein_id="ACF49914.1"
FT                   /translation="MTPIHETVPPTEVRMAEIVFPNHTNHLGTLFGGQALAWMDKAAFL
FT                   AAARYSRRTVVTARSDQVDFKLPIRIGQMVETIGRIVEVGRSSMKVEVELVAEDLHSGE
FT                   RKLCTRGHFVMIALDEEGHPIAVPPLPTA"
     atgaccccga tccacgagac cgtgccgccc accgaagtac gcatggccga aatcgtcttc        60
     cccaaccata ccaaccacct tggcaccctg ttcggtggcc aggcgctggc gtggatggac       120
     aaggccgcct tcctggccgc cgcacgctat tcgcgccgca ccgtggtgac cgcgcgcagc       180
     gaccaggtcg acttcaagct gccgatccgg atcggccaga tggtggaaac cattggccgc       240
     atcgtcgaag tcggccgcag ctcgatgaag gtggaggtgg aactggtcgc cgaagacctg       300
     cacagcggcg agcgcaagct gtgcacccgc ggccacttcg tgatgatcgc gctggacgag       360
     gaaggccacc cgatcgcggt gccgccgctg ccgacagcct ga                          402
//

If you have problems or comments...

PBIL Back to PBIL home page