(data stored in ACNUC7421 zone)

EMBL: CP001111.PE21

CP001111.PE21        Location/Qualifiers
FT   CDS_pept        complement(25398..26600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0021"
FT                   /product="Aspartate transaminase"
FT                   /EC_number="2.6.1.1"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   xac:XAC0125 aromatic amino acid aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49726"
FT                   /db_xref="GOA:B4SR25"
FT                   /db_xref="InterPro:IPR000796"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR25"
FT                   /protein_id="ACF49726.1"
FT                   /translation="MSFFANVELVPGDPILGLTEAYNADSRPTKVNLGVGIYYDESGRI
FT                   PLLRAVKQIEQQLANEAKPRGYLPIDGLPAYTQATRELVFGKDSPLLAAGRVTTAQTVG
FT                   GSGALRVGADVLKKLLPHATVALSNPSWENHRAVFSAAGFEVVDYTYFDPTTHGVNFDG
FT                   LLADLGKLEAGTVVLLHACCHNPTGADLTVTQWKQVAQLLKDKQLFPFIDMAYQGFDKG
FT                   IEQDGAAVRIIAEAGIDSFIVANSYSKSFSLYGERVGALSMVAPTAADAKAVQSQVKRV
FT                   IRTIYSSPSTHGAALVAGVLTNPELRAMWEQELTEMRERIHALRQGLVEKLAAAGAPQF
FT                   GFINEQAGMFSYSGLSREQVERLRDEFGIYAVGTGRICVAALNQNNLEYVAKAVATVAK
FT                   G"
     gtgtccttct ttgcaaacgt ggaactggtc ccaggcgacc cgatcctggg cctgaccgag        60
     gcgtacaacg ccgacagccg cccgaccaag gtcaacctgg gtgtgggcat ctactacgac       120
     gagagcggcc gcattccgct gctgcgcgcc gtcaagcaga tcgagcagca gctcgccaac       180
     gaggccaaac cgcgcggcta cctgccgatc gatggcctgc cggcgtacac gcaggcgacg       240
     cgtgagctgg tgttcggcaa ggactcgccg ctgctggccg ccggccgcgt caccaccgca       300
     cagaccgtcg gtggcagcgg tgcgctgcgt gtcggcgccg atgtgctgaa gaagctgctg       360
     ccgcacgcca ccgttgcact gagcaacccg agctgggaaa accatcgcgc cgtgttcagc       420
     gccgccggct tcgaggtggt ggattacacc tacttcgacc cgaccaccca tggcgtcaac       480
     ttcgatggcc tgctggccga cctcggcaag ctggaagccg gcaccgtggt gctgctgcac       540
     gcctgctgcc acaaccccac cggcgccgac ctcacggtca cccagtggaa gcaggtcgcg       600
     cagctgctga aggacaagca actgttcccc ttcatcgaca tggcctacca gggcttcgac       660
     aagggcatcg agcaggacgg cgctgccgtg cgcatcatcg ccgaagccgg catcgacagc       720
     ttcatcgtcg ccaactcgta ctccaagtcg ttctcgctgt acggcgagcg cgtgggtgcg       780
     ctgtcgatgg tggcgccgac cgctgctgac gccaaggccg tgcagtcgca ggtcaagcgc       840
     gtgatccgca ccatctactc cagcccgtcc acccatggtg ccgcgctggt ggcaggcgtg       900
     ctgaccaacc cggaactgcg cgcgatgtgg gagcaggagc tgaccgagat gcgcgagcgc       960
     atccacgcac tgcgccaggg cctggtcgag aagctggccg ctgccggtgc cccgcagttc      1020
     ggcttcatca acgaacaggc cggcatgttc tcctactccg gcctgagccg tgagcaggtc      1080
     gagcgcctgc gcgacgagtt cggcatctac gccgtcggca ccggccgcat ctgcgtggcc      1140
     gcgctgaacc agaacaacct ggaatacgtc gccaaggccg tggccaccgt cgccaagggc      1200
     tga                                                                    1203
//

If you have problems or comments...

PBIL Back to PBIL home page